Human MARVELD1/bA548K23.8/GB14 ORF/cDNA clone-Lentivirus particle (NM_031484)

Cat. No.: vGMLP004698

Pre-made Human MARVELD1/bA548K23.8/GB14 Lentiviral expression plasmid for MARVELD1 lentivirus packaging, MARVELD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MARVELD1/bA548K23.8 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004698 Human MARVELD1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004698
Gene Name MARVELD1
Accession Number NM_031484
Gene ID 83742
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 522 bp
Gene Alias bA548K23.8,GB14,MARVD1,MRVLDC1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCCCGCCGCCCCCGCGCCAGCCGCCGCCCCAGGCGCGTGCGGCCCGCGGCGCGGTGCGCCTGCAGCGGCCCTTCCTGCGCAGCCCGCTGGGCGTGTTGCGGCTGCTGCAGCTGCTGGCCGGCGCTGCCTTCTGGATCACTATCGCCACCAGCAAGTACCAGGGCCCCGTGCACTTCGCGCTCTTCGTGTCCGTGCTCTTCTGGCTGCTCACCCTGGGCCTCTACTTCCTCACGCTGCTGGGCAAGCACGAGCTGGTCCCCGTGCTGGGCTCGCGCTGGCTCATGGTCAACGTGGCGCACGATGTGCTGGCGGCCGCGCTCTACGGCGCCGCCACCGGCATCATGAGCGACCAGATGCAGCGCCACAGCTACTGCAACCTCAAGGATTACCCGCTCCCCTGCGCCTACCACGCCTTCCTGGCGGCCGCCGTCTGCGGCGGCGTCTGCCACGGCCTCTACCTGCTTTCGGCGCTCTATGGCTGCGGGCGTCGCTGCCAGGGCAAGCAGGAGGTGGCGTGA
ORF Protein Sequence MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0796-Ab Anti-MALD1/ MARVELD1/ GB14 monoclonal antibody
    Target Antigen GM-Tg-g-MP0796-Ag MARVELD1 VLP (virus-like particle)
    ORF Viral Vector pGMLP004698 Human MARVELD1 Lentivirus plasmid
    ORF Viral Vector vGMLP004698 Human MARVELD1 Lentivirus particle


    Target information

    Target ID GM-MP0796
    Target Name MARVELD1
    Gene ID 83742, 277010, 708237, 120097610, 105261035, 102155352, 616867, 102150979
    Gene Symbol and Synonyms bA548K23.8,GB14,MARVD1,MARVELD1,MRVLDC1
    Uniprot Accession Q9BSK0
    Uniprot Entry Name MALD1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000155254
    Target Classification Not Available

    Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in several cellular components, including cytoskeleton; nucleus; and plasma membrane. Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.