Human HOXD4/HHO.C13/Hox-4.2 ORF/cDNA clone-Lentivirus particle (NM_014621)

Cat. No.: vGMLP004767

Pre-made Human HOXD4/HHO.C13/Hox-4.2 Lentiviral expression plasmid for HOXD4 lentivirus packaging, HOXD4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HOXD4/HHO.C13 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004767 Human HOXD4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004767
Gene Name HOXD4
Accession Number NM_014621
Gene ID 3233
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 768 bp
Gene Alias HHO.C13,Hox-4.2,HOX-5.1,HOX4,HOX4B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCATGAGTTCGTATATGGTGAACTCCAAGTATGTGGACCCCAAGTTCCCTCCGTGCGAGGAGTATTTGCAGGGCGGCTACCTAGGCGAGCAGGGCGCCGACTACTACGGCGGCGGCGCGCAGGGCGCAGACTTCCAGCCCCCGGGGCTCTACCCACGGCCCGACTTCGGTGAGCAGCCTTTCGGAGGCAGCGGCCCCGGGCCTGGCTCGGCGCTGCCTGCGCGGGGTCACGGACAAGAGCCAGGCGGCCCCGGCGGTCACTACGCCGCTCCAGGAGAGCCTTGCCCAGCTCCCCCGGCGCCTCCGCCGGCGCCCCTGCCTGGCGCCCGGGCCTACAGTCAGTCCGACCCCAAGCAGCCGCCCTCCGGGACGGCACTCAAGCAGCCGGCCGTGGTCTACCCCTGGATGAAGAAGGTGCACGTGAATTCGGTGAACCCCAACTACACCGGTGGGGAACCCAAGCGGTCCCGAACGGCCTACACCCGGCAGCAAGTCCTAGAACTGGAAAAAGAATTTCATTTTAACAGGTATCTGACAAGGCGCCGTCGGATTGAAATCGCTCACACCCTGTGTCTGTCGGAGCGCCAGATCAAGATCTGGTTCCAGAACCGGAGGATGAAGTGGAAAAAAGATCATAAGCTGCCCAACACTAAAGGCAGGTCATCGTCCTCATCTTCCTCCTCATCTTGCTCCTCCTCAGTCGCCCCCAGCCAGCATTTACAGCCGATGGCCAAAGACCACCACACGGACCTGACGACCTTATAG
ORF Protein Sequence MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2540-Ab Anti-HOXD4 monoclonal antibody
    Target Antigen GM-Tg-g-IP2540-Ag HOXD4 protein
    ORF Viral Vector pGMLP004767 Human HOXD4 Lentivirus plasmid
    ORF Viral Vector vGMLP004767 Human HOXD4 Lentivirus particle


    Target information

    Target ID GM-IP2540
    Target Name HOXD4
    Gene ID 3233, 15436, 288153, 101098156, 119867836, 513306, 102149632
    Gene Symbol and Synonyms 6030436D05Rik,HHO.C13,Hox-4.2,HOX-5.1,HOX4,HOX4B,HOXD4
    Uniprot Accession P09016
    Uniprot Entry Name HXD4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000170166
    Target Classification Not Available

    This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.