Human CRISP1/AEGL1/ARP ORF/cDNA clone-Lentivirus particle (NM_170609)
Cat. No.: vGMLP004782
Pre-made Human CRISP1/AEGL1/ARP Lentiviral expression plasmid for CRISP1 lentivirus packaging, CRISP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CRISP1/AEGL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004782 | Human CRISP1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004782 |
Gene Name | CRISP1 |
Accession Number | NM_170609 |
Gene ID | 167 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 537 bp |
Gene Alias | AEGL1,ARP,CRISP-1,HEL-S-57,HSCRISP1D,HSCRISP1G,HUMARP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAAATTAAACACCTCTTGTTTTTGGTTGCTGCTGCTTGCTTACTGCCTATGTTGTCCATGAAAAAGAAATCAGCTAGAGACCAATTTAATAAGCTCGTCACCGACTTGCCAAATGTACAAGAAGAGATCGTTAATATACACAACGCCCTCAGGAGAAGAGTAGTTCCACCAGCCAGCAACATGCTGAAGATGAGTTGGAGTGAAGAGGCTGCACAAAATGCCAGAATTTTTTCAAAGTATTGTGATATGACAGAGAGCAACCCCCTTGAGAGGAGACTTCCAAATACCTTTTGTGGAGAAAATATGCATATGACATCTTATCCTGTATCATGGTCAAGTGTAATTGGAGTCTGGTACAGTGAGTCTACAAGTTTCAAACATGGAGAATGGACAACAACGGATGATGACATAACTACTGACCACTACACTCAGATTGTTTGGGCCACATCTTACCTGATTGGCTGTGCCATTGCATCTTGCCGCCAACAAGGATCACCTCGATATCTCTACGTTTGTCACTATTGTCATGACTAA |
ORF Protein Sequence | MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0820-Ab | Anti-CRIS1/ CRISP1/ AEGL1 functional antibody |
Target Antigen | GM-Tg-g-SE0820-Ag | CRISP1 protein |
ORF Viral Vector | pGMLP004782 | Human CRISP1 Lentivirus plasmid |
ORF Viral Vector | vGMLP004782 | Human CRISP1 Lentivirus particle |
Target information
Target ID | GM-SE0820 |
Target Name | CRISP1 |
Gene ID | 167, 11571, 574111, 654517, 101082060, 100855553, 616774, 100033953 |
Gene Symbol and Synonyms | AEG,Aeg1,AEGL1,ARP,CRISP-1,CRISP1,Crisp4,HEL-S-57,HSCRISP1D,HSCRISP1G,HUMARP,SCP 1 |
Uniprot Accession | P54107 |
Uniprot Entry Name | CRIS1_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000124812 |
Target Classification | Not Available |
Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head, where it plays a role in sperm-egg fusion. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.