Human CRISP1/AEGL1/ARP ORF/cDNA clone-Lentivirus particle (NM_170609)

Cat. No.: vGMLP004782

Pre-made Human CRISP1/AEGL1/ARP Lentiviral expression plasmid for CRISP1 lentivirus packaging, CRISP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CRISP1/AEGL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004782 Human CRISP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004782
Gene Name CRISP1
Accession Number NM_170609
Gene ID 167
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 537 bp
Gene Alias AEGL1,ARP,CRISP-1,HEL-S-57,HSCRISP1D,HSCRISP1G,HUMARP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAATTAAACACCTCTTGTTTTTGGTTGCTGCTGCTTGCTTACTGCCTATGTTGTCCATGAAAAAGAAATCAGCTAGAGACCAATTTAATAAGCTCGTCACCGACTTGCCAAATGTACAAGAAGAGATCGTTAATATACACAACGCCCTCAGGAGAAGAGTAGTTCCACCAGCCAGCAACATGCTGAAGATGAGTTGGAGTGAAGAGGCTGCACAAAATGCCAGAATTTTTTCAAAGTATTGTGATATGACAGAGAGCAACCCCCTTGAGAGGAGACTTCCAAATACCTTTTGTGGAGAAAATATGCATATGACATCTTATCCTGTATCATGGTCAAGTGTAATTGGAGTCTGGTACAGTGAGTCTACAAGTTTCAAACATGGAGAATGGACAACAACGGATGATGACATAACTACTGACCACTACACTCAGATTGTTTGGGCCACATCTTACCTGATTGGCTGTGCCATTGCATCTTGCCGCCAACAAGGATCACCTCGATATCTCTACGTTTGTCACTATTGTCATGACTAA
ORF Protein Sequence MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0820-Ab Anti-CRIS1/ CRISP1/ AEGL1 functional antibody
    Target Antigen GM-Tg-g-SE0820-Ag CRISP1 protein
    ORF Viral Vector pGMLP004782 Human CRISP1 Lentivirus plasmid
    ORF Viral Vector vGMLP004782 Human CRISP1 Lentivirus particle


    Target information

    Target ID GM-SE0820
    Target Name CRISP1
    Gene ID 167, 11571, 574111, 654517, 101082060, 100855553, 616774, 100033953
    Gene Symbol and Synonyms AEG,Aeg1,AEGL1,ARP,CRISP-1,CRISP1,Crisp4,HEL-S-57,HSCRISP1D,HSCRISP1G,HUMARP,SCP 1
    Uniprot Accession P54107
    Uniprot Entry Name CRIS1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000124812
    Target Classification Not Available

    Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head, where it plays a role in sperm-egg fusion. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.