Human HRH4/AXOR35/BG26 ORF/cDNA clone-Lentivirus particle (NM_001160166)
Cat. No.: vGMLP004787
Pre-made Human HRH4/AXOR35/BG26 Lentiviral expression plasmid for HRH4 lentivirus packaging, HRH4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
H4R/HRH4/AXOR35 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004787 | Human HRH4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004787 |
| Gene Name | HRH4 |
| Accession Number | NM_001160166 |
| Gene ID | 59340 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 204 bp |
| Gene Alias | AXOR35,BG26,GPCR105,GPRv53,H4,H4R,HH4R |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCAGATACTAATAGCACAATCAATTTATCACTAAGCACTCGTGTTACTTTAGCATTTTTTATGTCCTTAGTAGCTTTTGCTATAATGCTAGGAAATGCTTTGGTCATTTTAGCTTTTGTGGTGGACAAAAACCTTAGACATCGAAGTAGTTATTTTTTTCTTAACTTGGCCATCTCTGACTTCTTTGTGGGTGTCTTATAG |
| ORF Protein Sequence | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T26500-Ab | Anti-HRH4/ H4R/ AXOR35 monoclonal antibody |
| Target Antigen | GM-Tg-g-T26500-Ag | H4R/HRH4 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP004787 | Human HRH4 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004787 | Human HRH4 Lentivirus particle |
Target information
| Target ID | GM-T26500 |
| Target Name | H4R |
| Gene ID | 59340, 225192, 702044, 170704, 101100602, 490512, 783354, 100034111 |
| Gene Symbol and Synonyms | AXOR35,BG26,GPCR105,GPRv53,H4,H4R,HH4R,HRH4 |
| Uniprot Accession | Q9H3N8 |
| Uniprot Entry Name | HRH4_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000134489 |
| Target Classification | GPCR |
Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


