Human OR14I1/OR5BU1/OR5BU1P ORF/cDNA clone-Lentivirus particle (NM_001004734)
Cat. No.: vGMLP004840
Pre-made Human OR14I1/OR5BU1/OR5BU1P Lentiviral expression plasmid for OR14I1 lentivirus packaging, OR14I1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
OR14I1/OR5BU1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004840 | Human OR14I1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004840 |
Gene Name | OR14I1 |
Accession Number | NM_001004734 |
Gene ID | 401994 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 936 bp |
Gene Alias | OR5BU1,OR5BU1P |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACAATCTCACAAAAGTGACAGAATTCCTGCTGATGGAGTTTTCTGGTATCTGGGAGCTGCAGGTGCTGCACGCCGGGCTGTTTCTGCTGATTTATCTGGCAGTGCTGGTGGGGAACCTGCTCATCATTGCAGTCATCACTCTCGATCAGCATCTTCACACACCCATGTACTTCTTCCTGAAGAACCTCTCCGTTTTGGATCTGTGCTACATCTCAGTCACTGTGCCTAAATCCATCCGTAACTCCCTGACTCGCAGAAGCTCCATCTCTTATCTTGGCTGTGTGGCTCAAGTCTATTTTTTCTCTGCCTTTGCATCTGCTGAGCTGGCCTTCCTTACTGTCATGTCTTATGACCGCTATGTTGCCATTTGCCACCCCCTCCAATACAGAGCCGTGATGACATCAGGAGGGTGCTATCAGATGGCAGTCACCACCTGGCTAAGCTGCTTTTCCTACGCAGCCGTCCACACTGGCAACATGTTTCGGGAGCACGTTTGCAGATCCAGTGTGATCCACCAGTTCTTCCGTGACATCCCTCATGTGTTGGCCCTGGTTTCCTGTGAGGTTTTCTTTGTAGAGTTTTTGACCCTGGCCCTGAGCTCATGCTTGGTTCTGGGATGCTTTATTCTCATGATGATCTCCTATTTCCAAATCTTCTCAACGGTGCTCAGAATCCCTTCAGGACAGAGTCGAGCAAAAGCCTTCTCCACCTGCTCCCCCCAGCTCATTGTCATCATGCTCTTTCTTACCACAGGGCTCTTTGCTGCCTTAGGACCAATTGCAAAAGCTCTGTCCATTCAGGATTTAGTGATTGCTCTGACATACACAGTTTTGCCTCCCTTCCTCAATCCCATCATATATAGTCTTAGGAATAAGGAGATTAAAACAGCCATGTGGAGACTCTTTGTGAAGATATATTTTCTGCAAAAGTAG |
ORF Protein Sequence | MDNLTKVTEFLLMEFSGIWELQVLHAGLFLLIYLAVLVGNLLIIAVITLDQHLHTPMYFFLKNLSVLDLCYISVTVPKSIRNSLTRRSSISYLGCVAQVYFFSAFASAELAFLTVMSYDRYVAICHPLQYRAVMTSGGCYQMAVTTWLSCFSYAAVHTGNMFREHVCRSSVIHQFFRDIPHVLALVSCEVFFVEFLTLALSSCLVLGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLFAALGPIAKALSIQDLVIALTYTVLPPFLNPIIYSLRNKEIKTAMWRLFVKIYFLQK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0987-Ab | Anti-O14I1/ OR14I1/ OR5BU1 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0987-Ag | OR14I1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP004840 | Human OR14I1 Lentivirus plasmid |
ORF Viral Vector | vGMLP004840 | Human OR14I1 Lentivirus particle |
Target information
Target ID | GM-MP0987 |
Target Name | OR14I1 |
Gene ID | 401994, 100686790 |
Gene Symbol and Synonyms | OR14I1,OR14I2,OR5BU1,OR5BU1P |
Uniprot Accession | A6ND48 |
Uniprot Entry Name | O14I1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000189181 |
Target Classification | Not Available |
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.