Human OR14I1/OR5BU1/OR5BU1P ORF/cDNA clone-Lentivirus particle (NM_001004734)

Cat. No.: vGMLP004840

Pre-made Human OR14I1/OR5BU1/OR5BU1P Lentiviral expression plasmid for OR14I1 lentivirus packaging, OR14I1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to OR14I1/OR5BU1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004840 Human OR14I1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004840
Gene Name OR14I1
Accession Number NM_001004734
Gene ID 401994
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 936 bp
Gene Alias OR5BU1,OR5BU1P
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACAATCTCACAAAAGTGACAGAATTCCTGCTGATGGAGTTTTCTGGTATCTGGGAGCTGCAGGTGCTGCACGCCGGGCTGTTTCTGCTGATTTATCTGGCAGTGCTGGTGGGGAACCTGCTCATCATTGCAGTCATCACTCTCGATCAGCATCTTCACACACCCATGTACTTCTTCCTGAAGAACCTCTCCGTTTTGGATCTGTGCTACATCTCAGTCACTGTGCCTAAATCCATCCGTAACTCCCTGACTCGCAGAAGCTCCATCTCTTATCTTGGCTGTGTGGCTCAAGTCTATTTTTTCTCTGCCTTTGCATCTGCTGAGCTGGCCTTCCTTACTGTCATGTCTTATGACCGCTATGTTGCCATTTGCCACCCCCTCCAATACAGAGCCGTGATGACATCAGGAGGGTGCTATCAGATGGCAGTCACCACCTGGCTAAGCTGCTTTTCCTACGCAGCCGTCCACACTGGCAACATGTTTCGGGAGCACGTTTGCAGATCCAGTGTGATCCACCAGTTCTTCCGTGACATCCCTCATGTGTTGGCCCTGGTTTCCTGTGAGGTTTTCTTTGTAGAGTTTTTGACCCTGGCCCTGAGCTCATGCTTGGTTCTGGGATGCTTTATTCTCATGATGATCTCCTATTTCCAAATCTTCTCAACGGTGCTCAGAATCCCTTCAGGACAGAGTCGAGCAAAAGCCTTCTCCACCTGCTCCCCCCAGCTCATTGTCATCATGCTCTTTCTTACCACAGGGCTCTTTGCTGCCTTAGGACCAATTGCAAAAGCTCTGTCCATTCAGGATTTAGTGATTGCTCTGACATACACAGTTTTGCCTCCCTTCCTCAATCCCATCATATATAGTCTTAGGAATAAGGAGATTAAAACAGCCATGTGGAGACTCTTTGTGAAGATATATTTTCTGCAAAAGTAG
ORF Protein Sequence MDNLTKVTEFLLMEFSGIWELQVLHAGLFLLIYLAVLVGNLLIIAVITLDQHLHTPMYFFLKNLSVLDLCYISVTVPKSIRNSLTRRSSISYLGCVAQVYFFSAFASAELAFLTVMSYDRYVAICHPLQYRAVMTSGGCYQMAVTTWLSCFSYAAVHTGNMFREHVCRSSVIHQFFRDIPHVLALVSCEVFFVEFLTLALSSCLVLGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLFAALGPIAKALSIQDLVIALTYTVLPPFLNPIIYSLRNKEIKTAMWRLFVKIYFLQK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0987-Ab Anti-O14I1/ OR14I1/ OR5BU1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0987-Ag OR14I1 VLP (virus-like particle)
    ORF Viral Vector pGMLP004840 Human OR14I1 Lentivirus plasmid
    ORF Viral Vector vGMLP004840 Human OR14I1 Lentivirus particle


    Target information

    Target ID GM-MP0987
    Target Name OR14I1
    Gene ID 401994, 100686790
    Gene Symbol and Synonyms OR14I1,OR14I2,OR5BU1,OR5BU1P
    Uniprot Accession A6ND48
    Uniprot Entry Name O14I1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000189181
    Target Classification Not Available

    Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.