Human GALP ORF/cDNA clone-Lentivirus particle (NM_033106)

Cat. No.: vGMLP004967

Pre-made Human GALP/ Lentiviral expression plasmid for GALP lentivirus packaging, GALP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GALP/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004967 Human GALP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004967
Gene Name GALP
Accession Number NM_033106
Gene ID 85569
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 351 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCTCCCTCCGTCCCCCTGGTCCTCCTCCTCGTCCTCTTGCTGAGCCTGGCAGAGACTCCAGCATCCGCACCTGCCCACCGGGGACGAGGAGGCTGGACCCTCAATAGTGCTGGCTACCTTCTGGGTCCCGTCCTCCACCTTCCCCAAATGGGTGACCAAGACGGAAAGAGGGAGACAGCCCTTGAGATCCTAGACCTGTGGAAGGCCATCGACGGGCTCCCCTACTCCCACCCTCCACAGCCCTCCAAGAGGAATGTGATGGAGACGTTTGCCAAACCAGAGATTGGAGATCTGGGCATGCTCAGCATGAAAATTCCCAAGGAGGAAGATGTCCTGAAGTCATAG
ORF Protein Sequence MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0934-Ab Anti-GALP functional antibody
    Target Antigen GM-Tg-g-SE0934-Ag GALP protein
    ORF Viral Vector pGMLP004967 Human GALP Lentivirus plasmid
    ORF Viral Vector vGMLP004967 Human GALP Lentivirus particle


    Target information

    Target ID GM-SE0934
    Target Name GALP
    Gene ID 85569, 232836, 704323, 64568, 109494653, 102151546, 102150242
    Gene Symbol and Synonyms GAL,GALP
    Uniprot Accession Q9UBC7
    Uniprot Entry Name GALP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000197487
    Target Classification Not Available

    This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, has vasoactive properties, displays antimicrobial activity against E. coli, and may serve as a marker for neuroblastic tumors.



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.