Human TMEM18/lncND ORF/cDNA clone-Lentivirus particle (NM_152834)

Cat. No.: vGMLP005040

Pre-made Human TMEM18/lncND Lentiviral expression plasmid for TMEM18 lentivirus packaging, TMEM18 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM18/lncND products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005040 Human TMEM18 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005040
Gene Name TMEM18
Accession Number NM_152834
Gene ID 129787
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 423 bp
Gene Alias lncND
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGTCCGCCTTCTCTGTCAGCTCTTTCCCCGTCAGCATCCCAGCCGTGCTCACGCAGACGGACTGGACTGAGCCCTGGCTCATGGGGCTGGCCACCTTCCACGCGCTCTGCGTGCTCCTCACCTGCTTGTCCTCCCGAAGCTACAGACTACAGATCGGGCACTTTCTGTGTCTAGTCATCTTAGTCTACTGTGCTGAATACATCAATGAGGCGGCTGCGATGAACTGGAGATTATTTTCGAAATACCAGTATTTCGACTCCAGGGGGATGTTCATTTCTATAGTATTTTCAGCCCCACTGCTGGTGAATGCCATGATCATTGTGGTTATGTGGGTATGGAAGACTTTGAATGTGATGACTGACCTGAAGAATGCACAAGAGAGAAGAAAGGAAAAGAAAAGGAGAAGGAAAGAAGACTGA
ORF Protein Sequence MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2021-Ab Anti-TMEM18 monoclonal antibody
    Target Antigen GM-Tg-g-IP2021-Ag TMEM18 protein
    ORF Viral Vector pGMLP005040 Human TMEM18 Lentivirus plasmid
    ORF Viral Vector vGMLP005040 Human TMEM18 Lentivirus particle


    Target information

    Target ID GM-IP2021
    Target Name TMEM18
    Gene ID 129787, 211986, 721515, 362722, 101092101, 607064, 616554, 100073041
    Gene Symbol and Synonyms lncND,TMEM18
    Uniprot Accession Q96B42
    Uniprot Entry Name TMM18_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000151353
    Target Classification Not Available

    Predicted to enable DNA binding activity. Involved in cell migration. Located in nuclear membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.