Human RLN3/H3/insl7 ORF/cDNA clone-Lentivirus particle (NM_080864)
Cat. No.: vGMLP005057
Pre-made Human RLN3/H3/insl7 Lentiviral expression plasmid for RLN3 lentivirus packaging, RLN3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
RLN3/H3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP005057 | Human RLN3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP005057 |
Gene Name | RLN3 |
Accession Number | NM_080864 |
Gene ID | 117579 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 429 bp |
Gene Alias | H3,insl7,RXN3,ZINS4 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCAGGTACATGCTGCTGCTGCTCCTGGCGGTATGGGTGCTGACCGGGGAGCTGTGGCCGGGAGCTGAGGCCCGGGCAGCGCCTTACGGGGTCAGGCTTTGCGGCCGAGAATTCATCCGAGCAGTCATCTTCACCTGCGGGGGCTCCCGGTGGAGACGATCAGACATCCTGGCCCACGAGGCTATGGGAGATACCTTCCCGGATGCAGATGCTGATGAAGACAGTCTGGCAGGCGAGCTGGATGAGGCCATGGGGTCCAGCGAGTGGCTGGCCCTGACCAAGTCACCCCAGGCCTTTTACAGGGGGCGACCCAGCTGGCAAGGAACCCCTGGGGTTCTTCGGGGCAGCCGAGATGTCCTGGCTGGCCTTTCCAGCAGCTGCTGCAAGTGGGGGTGTAGCAAAAGTGAAATCAGTAGCCTTTGCTAG |
ORF Protein Sequence | MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1243-Ab | Anti-REL3/ RLN3/ H3 functional antibody |
Target Antigen | GM-Tg-g-SE1243-Ag | RLN3 protein |
ORF Viral Vector | pGMLP005057 | Human RLN3 Lentivirus plasmid |
ORF Viral Vector | vGMLP005057 | Human RLN3 Lentivirus particle |
Target information
Target ID | GM-SE1243 |
Target Name | RLN3 |
Gene ID | 117579, 212108, 717577, 266997, 101090240, 119864730, 100300034, 100630151 |
Gene Symbol and Synonyms | H3,insl7,M3,RLN3,RLX3,RXN3,ZINS4 |
Uniprot Accession | Q8WXF3 |
Uniprot Entry Name | REL3_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000171136 |
Target Classification | Not Available |
This gene encodes a member of the relaxin family of insulin-like hormones that is expressed predominantly in the brain and plays a role in physiological processes such as stress, memory and appetite regulation. The encoded protein is a precursor that is proteolytically processed to generate a heterodimeric mature form consisting A and B chains interlinked by disulfide bonds. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.