Human SIGMAR1/ALS16/DSMA2 ORF/cDNA clone-Lentivirus particle (NM_005866.3)
Cat. No.: vGMLV000203
Pre-made Human SIGMAR1/ALS16/DSMA2 Lentiviral expression plasmid for SIGMAR1 lentivirus packaging, SIGMAR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
OPRS1/SIGMAR1/ALS16 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000203 | Human SIGMAR1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000203 |
| Gene Name | SIGMAR1 |
| Accession Number | NM_005866.3 |
| Gene ID | 10280 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 672 bp |
| Gene Alias | ALS16,DSMA2,hSigmaR1,OPRS1,SIG-1R,sigma1R,SR-BP,SR-BP1,SRBP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGTGGGCCGTGGGCCGGCGGTGGGCGTGGGCCGCGCTGCTCCTGGCTGTCGCAGCGGTGCTGACCCAGGTCGTCTGGCTCTGGCTGGGTACGCAGAGCTTCGTCTTCCAGCGCGAAGAGATAGCGCAGTTGGCGCGGCAGTACGCTGGGCTGGACCACGAGCTGGCCTTCTCTCGTCTGATCGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCCGACGAGGAGCTGCAGTGGGTGTTCGTGAATGCGGGTGGCTGGATGGGCGCCATGTGCCTTCTGCACGCCTCGCTGTCCGAGTATGTGCTGCTCTTCGGCACCGCCTTGGGCTCCCGCGGCCACTCGGGGCGCTACTGGGCTGAGATCTCGGATACCATCATCTCTGGCACCTTCCACCAGTGGAGAGAGGGCACCACCAAAAGTGAGGTCTTCTACCCAGGGGAGACGGTAGTACACGGGCCTGGTGAGGCAACAGCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAGTACGGCCGGGGCGTCATCCCATCCACCCTGGCCTTCGCGCTGGCCGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTCTATACTCTTCGCTCCTATGCTCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTTGGCCAGGACCCTTGA |
| ORF Protein Sequence | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0013-Ab | Anti-OPRS1 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0013-Ag | OPRS1/SIGMAR1 protein |
| ORF Viral Vector | pGMLV000203 | Human SIGMAR1 Lentivirus plasmid |
| ORF Viral Vector | vGMLV000203 | Human SIGMAR1 Lentivirus particle |
Target information
| Target ID | GM-IP0013 |
| Target Name | OPRS1 |
| Gene ID | 10280, 18391, 700469, 29336, 101084912, 481587, 538903, 100068507 |
| Gene Symbol and Synonyms | ALS16,DSMA2,hSigmaR1,OPRS1,SIG-1R,Sig1R,sigma1R,SIGMAR1,SR-BP,SR-BP1,SRBP |
| Uniprot Accession | Q99720 |
| Uniprot Entry Name | SGMR1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000147955 |
| Target Classification | Not Available |
This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq, Aug 2013]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


