Human JUN/AP-1/AP1 ORF/cDNA clone-Lentivirus particle (NM_002228.3)
Cat. No.: vGMLV000295
Pre-made Human JUN/AP-1/AP1 Lentiviral expression plasmid for JUN lentivirus packaging, JUN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
JUN/AP-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV000295 | Human JUN Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV000295 |
Gene Name | JUN |
Accession Number | NM_002228.3 |
Gene ID | 3725 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 996 bp |
Gene Alias | AP-1,AP1,c-Jun,p39 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTGCAAAGATGGAAACGACCTTCTATGACGATGCCCTCAACGCCTCGTTCCTCCCGTCCGAGAGCGGACCTTATGGCTACAGTAACCCCAAGATCCTGAAACAGAGCATGACCCTGAACCTGGCCGACCCAGTGGGGAGCCTGAAGCCGCACCTCCGCGCCAAGAACTCGGACCTCCTCACCTCGCCCGACGTGGGGCTGCTCAAGCTGGCGTCGCCCGAGCTGGAGCGCCTGATAATCCAGTCCAGCAACGGGCACATCACCACCACGCCGACCCCCACCCAGTTCCTGTGCCCCAAGAACGTGACAGATGAGCAGGAGGGCTTCGCCGAGGGCTTCGTGCGCGCCCTGGCCGAACTGCACAGCCAGAACACGCTGCCCAGCGTCACGTCGGCGGCGCAGCCGGTCAACGGGGCAGGCATGGTGGCTCCCGCGGTAGCCTCGGTGGCAGGGGGCAGCGGCAGCGGCGGCTTCAGCGCCAGCCTGCACAGCGAGCCGCCGGTCTACGCAAACCTCAGCAACTTCAACCCAGGCGCGCTGAGCAGCGGCGGCGGGGCGCCCTCCTACGGCGCGGCCGGCCTGGCCTTTCCCGCGCAACCCCAGCAGCAGCAGCAGCCGCCGCACCACCTGCCCCAGCAGATGCCCGTGCAGCACCCGCGGCTGCAGGCCCTGAAGGAGGAGCCTCAGACAGTGCCCGAGATGCCCGGCGAGACACCGCCCCTGTCCCCCATCGACATGGAGTCCCAGGAGCGGATCAAGGCGGAGAGGAAGCGCATGAGGAACCGCATCGCTGCCTCCAAGTGCCGAAAAAGGAAGCTGGAGAGAATCGCCCGGCTGGAGGAAAAAGTGAAAACCTTGAAAGCTCAGAACTCGGAGCTGGCGTCCACGGCCAACATGCTCAGGGAACAGGTGGCACAGCTTAAACAGAAAGTCATGAACCACGTTAACAGTGGGTGCCAACTCATGCTAACGCAGCAGTTGCAAACATTTTGA |
ORF Protein Sequence | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T69085-Ab | Anti-JUN monoclonal antibody |
Target Antigen | GM-Tg-g-T69085-Ag | JUN protein |
ORF Viral Vector | pGMLP005587 | Human JUN Lentivirus plasmid |
ORF Viral Vector | pGMLV000295 | Human JUN Lentivirus plasmid |
ORF Viral Vector | pGMLV001471 | Human JUN Lentivirus plasmid |
ORF Viral Vector | pGMAD000140 | Human JUN Adenovirus plasmid |
ORF Viral Vector | pGMAD000912 | Human JUN Adenovirus plasmid |
ORF Viral Vector | pGMAD001483 | Human JUN Adenovirus plasmid |
ORF Viral Vector | pGMAP000535 | Human JUN Adenovirus plasmid |
ORF Viral Vector | pGMLP-SPh-129 | Human JUN Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-269 | Human JUN Adenovirus plasmid |
ORF Viral Vector | pGMPC000142 | Human JUN Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP005587 | Human JUN Lentivirus particle |
ORF Viral Vector | vGMLV000295 | Human JUN Lentivirus particle |
ORF Viral Vector | vGMLV001471 | Human JUN Lentivirus particle |
ORF Viral Vector | vGMAD000140 | Human JUN Adenovirus particle |
ORF Viral Vector | vGMAD000912 | Human JUN Adenovirus particle |
ORF Viral Vector | vGMAD001483 | Human JUN Adenovirus particle |
ORF Viral Vector | vGMAP000535 | Human JUN Adenovirus particle |
ORF Viral Vector | vGMLP-SPh-129 | Human JUN Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-269 | Human JUN Adenovirus particle |
Target information
Target ID | GM-T69085 |
Target Name | JUN |
Gene ID | 3725, 16476, 716452, 24516, 101097261, 609429, 280831, 100067469 |
Gene Symbol and Synonyms | AP-1,AP1,c-Jun,cJUN,JUN,Junc,p39 |
Uniprot Accession | P05412 |
Uniprot Entry Name | JUN_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000177606 |
Target Classification | Tumor-associated antigen (TAA) |
This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.