Human GAP43/B-50/PP46 ORF/cDNA clone-Lentivirus particle (NM_002045.3)
Cat. No.: vGMLV000306
Pre-made Human GAP43/B-50/PP46 Lentiviral expression plasmid for GAP43 lentivirus packaging, GAP43 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GAP43/B-50 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000306 | Human GAP43 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000306 |
| Gene Name | GAP43 |
| Accession Number | NM_002045.3 |
| Gene ID | 2596 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 717 bp |
| Gene Alias | B-50,PP46 |
| Fluorescent Reporter | Firefly luciferase |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTGTGCTGTATGAGAAGAACCAAACAGGTTGAAAAAAATGATGACGACCAAAAGATTGAACAAGATGGTATCAAACCAGAAGATAAAGCTCATAAGGCCGCAACCAAAATTCAGGCTAGCTTCCGTGGACACATAACAAGGAAAAAGCTCAAAGGAGAGAAGAAGGATGATGTCCAAGCTGCTGAGGCTGAAGCTAATAAGAAGGATGAAGCCCCTGTTGCCGATGGGGTGGAGAAGAAGGGAGAAGGCACCACTACTGCCGAAGCAGCCCCAGCCACTGGCTCCAAGCCTGATGAGCCCGGCAAAGCAGGAGAAACTCCTTCCGAGGAGAAGAAGGGGGAGGGTGATGCTGCCACAGAGCAGGCAGCCCCCCAGGCTCCTGCATCCTCAGAGGAGAAGGCCGGCTCAGCTGAGACAGAAAGTGCCACTAAAGCTTCCACTGATAACTCGCCGTCCTCCAAGGCTGAAGATGCCCCAGCCAAGGAGGAGCCTAAACAAGCCGATGTGCCTGCTGCTGTCACTGCTGCTGCTGCCACCACCCCTGCCGCAGAGGATGCTGCTGCCAAGGCAACAGCCCAGCCTCCAACGGAGACTGGGGAGAGCAGCCAAGCTGAAGAGAACATAGAAGCTGTAGATGAAACCAAACCTAAGGAAAGTGCCCGGCAGGACGAGGGTAAAGAAGAGGAACCTGAGGCTGACCAAGAACATGCCTGA |
| ORF Protein Sequence | MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T93966-Ab | Anti-NEUM/ GAP43/ B-50 monoclonal antibody |
| Target Antigen | GM-Tg-g-T93966-Ag | GAP43 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP004662 | Human GAP43 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000306 | Human GAP43 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004662 | Human GAP43 Lentivirus particle |
| ORF Viral Vector | vGMLV000306 | Human GAP43 Lentivirus particle |
Target information
| Target ID | GM-T93966 |
| Target Name | GAP43 |
| Gene ID | 2596, 14432, 711260, 29423, 493873, 478572, 281777, 100061125 |
| Gene Symbol and Synonyms | B-50,Basp2,GAP-43,GAP43,PP46 |
| Uniprot Accession | P17677 |
| Uniprot Entry Name | NEUM_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000172020 |
| Target Classification | Not Available |
The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


