Human SNCA/NACP/PARK1 ORF/cDNA clone-Lentivirus particle (NM_000345.3)
                                                               Cat. No.: vGMLV000451
 
                                                               
                                                               
                                                                
                                                                
                                                                 
                                                                
                                                            
Pre-made Human SNCA/NACP/PARK1 Lentiviral expression plasmid for SNCA lentivirus packaging, SNCA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
                                                                            SNCA/NACP products
                                                                            collection>>
(antibodies,
                                                                            antigen, VLP, mRNA, ORF viral vector, etc)
                                                                        
                                                                    
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity | 
|---|---|---|---|
| vGMLV000451 | Human SNCA Lentivirus particle | Pilot Grade | 1.0E+8TU | 
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry | 
Product Description
| Catalog ID | vGMLV000451 | 
| Gene Name | SNCA | 
| Accession Number | NM_000345.3 | 
| Gene ID | 6622 | 
| Species | Human | 
| Product Type | Lentivirus particle (overexpression) | 
| Insert Length | 423 bp | 
| Gene Alias | NACP,PARK1,PARK4,PD1 | 
| Fluorescent Reporter | ZsGreen | 
| Mammalian Cell Selection | Puromyocin | 
| Fusion Tag | 3xflag (C-Terminal) | 
| Promoter | CMV | 
| Resistance | Amplicin | 
| ORF Nucleotide Sequence | ATGGATGTATTCATGAAAGGACTTTCAAAGGCCAAGGAGGGAGTTGTGGCTGCTGCTGAGAAAACCAAACAGGGTGTGGCAGAAGCAGCAGGAAAGACAAAAGAGGGTGTTCTCTATGTAGGCTCCAAAACCAAGGAGGGAGTGGTGCATGGTGTGGCAACAGTGGCTGAGAAGACCAAAGAGCAAGTGACAAATGTTGGAGGAGCAGTGGTGACGGGTGTGACAGCAGTAGCCCAGAAGACAGTGGAGGGAGCAGGGAGCATTGCAGCAGCCACTGGCTTTGTCAAAAAGGACCAGTTGGGCAAGAATGAAGAAGGAGCCCCACAGGAAGGAATTCTGGAAGATATGCCTGTGGATCCTGACAATGAGGCTTATGAAATGCCTTCTGAGGAAGGGTATCAAGACTACGAACCTGAAGCCTAA | 
| ORF Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA | 
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T03644 | 
| Target Name | SNCA | 
| Gene ID | 6622, 20617, 706985, 29219, 101091694, 478478, 282857, 100053270 | 
| Gene Symbol and Synonyms | alpha-Syn,alphaSYN,NACP,PARK1,PARK4,PD1,SNCA | 
| Uniprot Accession | P37840 | 
| Uniprot Entry Name | SYUA_HUMAN | 
| Protein Sub-location | Transmembrane Protein | 
| Category | Therapeutics Target, Diagnostics Biomarker, INN Index | 
| Disease | Not Available | 
| Gene Ensembl | ENSG00000145335 | 
| Target Classification | Not Available | 
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.
                
                
            
        
        
                                                            

