Human PTP4A3/PRL-3/PRL-R ORF/cDNA clone-Lentivirus particle (NM_007079.3)
Cat. No.: vGMLV001318
Pre-made Human PTP4A3/PRL-3/PRL-R Lentiviral expression plasmid for PTP4A3 lentivirus packaging, PTP4A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PRL-3/PTP4A3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV001318 | Human PTP4A3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV001318 |
Gene Name | PTP4A3 |
Accession Number | NM_007079.3 |
Gene ID | 11156 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 447 bp |
Gene Alias | PRL-3,PRL-R,PRL3 |
Fluorescent Reporter | mCherry |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTCGGATGAACCGCCCGGCCCCGGTGGAGGTGAGCTACAAACACATGCGCTTCCTCATCACCCACAACCCCACCAACGCCACGCTCAGCACCTTCATTGAGGACCTGAAGAAGTACGGGGCTACCACTGTGGTGCGTGTGTGTGAAGTGACCTATGACAAAACGCCGCTGGAGAAGGATGGCATCACCGTTGTGGACTGGCCGTTTGACGATGGGGCGCCCCCGCCCGGCAAGGTAGTGGAAGACTGGCTGAGCCTGGTGAAGGCCAAGTTCTGTGAGGCCCCCGGCAGCTGCGTGGCTGTGCACTGCGTGGCGGGCCTGGGCCGGAAGCGCCGCGGAGCCATCAACAGCAAGCAGCTCACCTACCTGGAGAAATACCGGCCCAAACAGAGGCTGCGGTTCAAAGACCCACACACGCACAAGACCCGGTGCTGCGTTATGTAG |
ORF Protein Sequence | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T78019-Ab | Anti-PRL-3 monoclonal antibody |
Target Antigen | GM-Tg-g-T78019-Ag | PRL-3/PTP4A3 protein |
ORF Viral Vector | pGMLP000864 | Human PTP4A3 Lentivirus plasmid |
ORF Viral Vector | pGMLV001318 | Human PTP4A3 Lentivirus plasmid |
ORF Viral Vector | vGMLP000864 | Human PTP4A3 Lentivirus particle |
ORF Viral Vector | vGMLV001318 | Human PTP4A3 Lentivirus particle |
Target information
Target ID | GM-T78019 |
Target Name | PRL-3 |
Gene ID | 11156, 19245, 693703, 362930, 101096639, 606961, 100137722, 100058296 |
Gene Symbol and Synonyms | pPtp4a3,PRL-3,PRL-R,PRL3,PTP4A3 |
Uniprot Accession | O75365 |
Uniprot Entry Name | TP4A3_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000184489 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.