Human TXNDC12/AG1/AGR1 ORF/cDNA clone-Lentivirus particle (NM_015913)
Cat. No.: vGMLV001789
Pre-made Human TXNDC12/AG1/AGR1 Lentiviral expression plasmid for TXNDC12 lentivirus packaging, TXNDC12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
TXNDC12/AG1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV001789 | Human TXNDC12 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV001789 |
| Gene Name | TXNDC12 |
| Accession Number | NM_015913 |
| Gene ID | 51060 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 519 bp |
| Gene Alias | AG1,AGR1,ERP16,ERP18,ERP19,hAG-1,hTLP19,PDIA16,TLP19 |
| Fluorescent Reporter | Firefly luciferase |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGACGCGGCCTCGTCTCGGGGCCACCTGTTTGCTGGGCTTCAGTTTCCTGCTCCTCGTCATCTCTTCTGATGGACATAATGGGCTTGGAAAGGGTTTTGGAGATCATATTCATTGGAGGACACTGGAAGATGGGAAGAAAGAAGCAGCTGCCAGTGGACTGCCCCTGATGGTGATTATTCATAAATCCTGGTGTGGAGCTTGCAAAGCTCTAAAGCCCAAATTTGCAGAATCTACGGAAATTTCAGAACTCTCCCATAATTTTGTTATGGTAAATCTTGAGGATGAAGAGGAACCCAAAGATGAAGATTTCAGCCCTGACGGGGGTTATATTCCACGAATCCTTTTTCTGGATCCCAGTGGCAAGGTGCATCCTGAAATCATCAATGAGAATGGAAACCCCAGCTACAAGTATTTTTATGTCAGTGCCGAGCAAGTTGTTCAGGGGATGAAGGAAGCTCAGGAAAGGCTGACGGGTGATGCCTTCAGAAAGAAACATCTTGAAGATGAATTGTAA |
| ORF Protein Sequence | METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T36419-Ab | Anti-TXD12/ TXNDC12/ AG1 functional antibody |
| Target Antigen | GM-Tg-g-T36419-Ag | TXNDC12 protein |
| ORF Viral Vector | pGMLP004211 | Human TXNDC12 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001789 | Human TXNDC12 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004211 | Human TXNDC12 Lentivirus particle |
| ORF Viral Vector | vGMLV001789 | Human TXNDC12 Lentivirus particle |
Target information
| Target ID | GM-T36419 |
| Target Name | TXNDC12 |
| Gene ID | 51060, 66073, 712891, 298370, 101089631, 609843, 506991, 100062254 |
| Gene Symbol and Synonyms | 0610040B21Rik,AG1,AGR1,ERP16,ERP18,ERP19,hAG-1,hTLP19,PDIA16,RGD1305960,TLP19,TXNDC12 |
| Uniprot Accession | O95881 |
| Uniprot Entry Name | TXD12_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000117862 |
| Target Classification | Not Available |
This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


