Human SAA1/PIG4/SAA ORF/cDNA clone-Lentivirus particle (NM_000331.6)
Cat. No.: vGMLV002502
Pre-made Human SAA1/PIG4/SAA Lentiviral expression plasmid for SAA1 lentivirus packaging, SAA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SAA1/PIG4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV002502 | Human SAA1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV002502 |
| Gene Name | SAA1 |
| Accession Number | NM_000331.6 |
| Gene ID | 6288 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 369 bp |
| Gene Alias | PIG4,SAA,SAA2,TP53I4 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAGCTTCTCACGGGCCTGGTTTTCTGCTCCTTGGTCCTGGGTGTCAGCAGCCGAAGCTTCTTTTCGTTCCTTGGCGAGGCTTTTGATGGGGCTCGGGACATGTGGAGAGCCTACTCTGACATGAGAGAAGCCAATTACATCGGCTCAGACAAATACTTCCATGCTCGGGGGAACTATGATGCTGCCAAAAGGGGACCTGGGGGTGCCTGGGCTGCAGAAGTGATCACCGATGCCAGAGAGAATATCCAGAGATTCTTTGGCCATGGTGCGGAGGACTCGCTGGCTGATCAGGCTGCCAATGAATGGGGCAGGAGTGGCAAAGACCCCAATCACTTCCGACCTGCTGGCCTGCCTGAGAAATACTGA |
| ORF Protein Sequence | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-654 | Pre-Made Anselamimab biosimilar, Whole mAb, Anti-SAA1 Antibody: Anti-PIG4/SAA/SAA2/TP53I4 therapeutic antibody |
| Biosimilar | GMP-Bios-ab-072 | Pre-Made Birtamimab biosimilar, Whole mAb, Anti-SAA1 Antibody: Anti-PIG4/SAA/SAA2/TP53I4 therapeutic antibody |
| Target Antibody | GM-Tg-g-T55447-Ab | Anti-SAA1/ PIG4/ SAA functional antibody |
| Target Antigen | GM-Tg-g-T55447-Ag | SAA1 protein |
| ORF Viral Vector | pGMLP003395 | Human SAA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002410 | Human SAA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002502 | Human SAA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002619 | Human SAA1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003395 | Human SAA1 Lentivirus particle |
| ORF Viral Vector | vGMLV002410 | Human SAA1 Lentivirus particle |
| ORF Viral Vector | vGMLV002502 | Human SAA1 Lentivirus particle |
| ORF Viral Vector | vGMLV002619 | Human SAA1 Lentivirus particle |
Target information
| Target ID | GM-T55447 |
| Target Name | SAA1 |
| Gene ID | 6288, 694944, 119865027 |
| Gene Symbol and Synonyms | PIG4,SAA,SAA1,SAA2,TP53I4 |
| Uniprot Accession | P0DJI8 |
| Uniprot Entry Name | SAA1_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker, INN Index |
| Disease | Not Available |
| Gene Ensembl | ENSG00000173432 |
| Target Classification | Not Available |
This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


