Human SAA1/PIG4/SAA ORF/cDNA clone-Lentivirus particle (NM_000331.6)

Cat. No.: vGMLV002410

Pre-made Human SAA1/PIG4/SAA Lentiviral expression plasmid for SAA1 lentivirus packaging, SAA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SAA1/PIG4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV002410 Human SAA1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV002410
Gene Name SAA1
Accession Number NM_000331.6
Gene ID 6288
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 369 bp
Gene Alias PIG4,SAA,SAA2,TP53I4
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTTCTCACGGGCCTGGTTTTCTGCTCCTTGGTCCTGGGTGTCAGCAGCCGAAGCTTCTTTTCGTTCCTTGGCGAGGCTTTTGATGGGGCTCGGGACATGTGGAGAGCCTACTCTGACATGAGAGAAGCCAATTACATCGGCTCAGACAAATACTTCCATGCTCGGGGGAACTATGATGCTGCCAAAAGGGGACCTGGGGGTGCCTGGGCTGCAGAAGTGATCACCGATGCCAGAGAGAATATCCAGAGATTCTTTGGCCATGGTGCGGAGGACTCGCTGGCTGATCAGGCTGCCAATGAATGGGGCAGGAGTGGCAAAGACCCCAATCACTTCCGACCTGCTGGCCTGCCTGAGAAATACTGA
ORF Protein Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-654 Pre-Made Anselamimab biosimilar, Whole mAb, Anti-SAA1 Antibody: Anti-PIG4/SAA/SAA2/TP53I4 therapeutic antibody
    Biosimilar GMP-Bios-ab-072 Pre-Made Birtamimab biosimilar, Whole mAb, Anti-SAA1 Antibody: Anti-PIG4/SAA/SAA2/TP53I4 therapeutic antibody
    Target Antibody GM-Tg-g-T55447-Ab Anti-SAA1/ PIG4/ SAA functional antibody
    Target Antigen GM-Tg-g-T55447-Ag SAA1 protein
    ORF Viral Vector pGMLP003395 Human SAA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002410 Human SAA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002502 Human SAA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002619 Human SAA1 Lentivirus plasmid
    ORF Viral Vector vGMLP003395 Human SAA1 Lentivirus particle
    ORF Viral Vector vGMLV002410 Human SAA1 Lentivirus particle
    ORF Viral Vector vGMLV002502 Human SAA1 Lentivirus particle
    ORF Viral Vector vGMLV002619 Human SAA1 Lentivirus particle


    Target information

    Target ID GM-T55447
    Target Name SAA1
    Gene ID 6288, 694944, 119865027
    Gene Symbol and Synonyms PIG4,SAA,SAA1,SAA2,TP53I4
    Uniprot Accession P0DJI8
    Uniprot Entry Name SAA1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, INN Index
    Disease Not Available
    Gene Ensembl ENSG00000173432
    Target Classification Not Available

    This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.