Human CSH2/CS-2/CSB ORF/cDNA clone-Lentivirus particle (NM_020991)
Cat. No.: vGMLV002681
Pre-made Human CSH2/CS-2/CSB Lentiviral expression plasmid for CSH2 lentivirus packaging, CSH2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CSH2/CS-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV002681 | Human CSH2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV002681 |
Gene Name | CSH2 |
Accession Number | NM_020991 |
Gene ID | 1443 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 654 bp |
Gene Alias | CS-2,CSB,GHB1,hCS-B,PL |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTGCAGGCTCCCGGACGTCCCTGCTCCTGGCTTTTGCCCTGCTCTGCCTGCCCTGGCTTCAAGAGGCTGGTGCCGTCCAAACCGTTCCGTTATCCAGGCTTTTTGACCACGCTATGCTCCAAGCCCATCGCGCGCACCAGCTGGCCATTGACACCTACCAGGAGTTTGAAGAAACCTATATCCCAAAGGACCAGAAGTATTCATTCCTGCATGACTCCCAGACCTCCTTCTGCTTCTCAGACTCTATTCCGACACCCTCCAACATGGAGGAAACGCAACAGAAATCCAATCTAGAGCTGCTCCGCATCTCCCTGCTGCTCATCGAGTCGTGGCTGGAGCCCGTGCGGTTCCTCAGGAGTATGTTCGCCAACAACCTGGTGTATGACACCTCGGACAGCGATGACTATCACCTCCTAAAGGACCTAGAGGAAGGCATCCAAACGCTGATGGGGAGGCTGGAAGACGGCAGCCGCCGGACTGGGCAGATCCTCAAGCAGACCTACAGCAAGTTTGACACAAACTCACACAACCATGACGCACTGCTCAAGAACTACGGGCTGCTCTACTGCTTCAGGAAGGACATGGACAAGGTCGAGACATTCCTGCGCATGGTGCAGTGCCGCTCTGTAGAGGGTAGCTGTGGCTTCTAG |
ORF Protein Sequence | MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0827-Ab | Anti-CSH2/ CS-2/ CSB functional antibody |
Target Antigen | GM-Tg-g-SE0827-Ag | CSH2 protein |
ORF Viral Vector | pGMLP002297 | Human CSH2 Lentivirus plasmid |
ORF Viral Vector | pGMLV002681 | Human CSH2 Lentivirus plasmid |
ORF Viral Vector | vGMLP002297 | Human CSH2 Lentivirus particle |
ORF Viral Vector | vGMLV002681 | Human CSH2 Lentivirus particle |
Target information
Target ID | GM-SE0827 |
Target Name | CSH2 |
Gene ID | 1443 |
Gene Symbol and Synonyms | CS-2,CSB,CSH2,GHB1,hCS-B,PL |
Uniprot Accession | P0DML3 |
Uniprot Entry Name | CSH2_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000213218 |
Target Classification | Not Available |
The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.