Human LY6D/E48/Ly-6D ORF/cDNA clone-Lentivirus particle (NM_003695.3)

Cat. No.: vGMLV002718

Pre-made Human LY6D/E48/Ly-6D Lentiviral expression plasmid for LY6D lentivirus packaging, LY6D lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LY6D/E48 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV002718 Human LY6D Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV002718
Gene Name LY6D
Accession Number NM_003695.3
Gene ID 8581
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 387 bp
Gene Alias E48,Ly-6D
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 1xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGACAGCATTGCTGCTCCTTGCAGCCCTGGCTGTGGCTACAGGGCCAGCCCTTACCCTGCGCTGCCACGTGTGCACCAGCTCCAGCAACTGCAAGCATTCTGTGGTCTGCCCGGCCAGCTCTCGCTTCTGCAAGACCACGAACACAGTGGAGCCTCTGAGGGGGAATCTGGTGAAGAAGGACTGTGCGGAGTCGTGCACACCCAGCTACACCCTGCAAGGCCAGGTCAGCAGCGGCACCAGCTCCACCCAGTGCTGCCAGGAGGACCTGTGCAATGAGAAGCTGCACAACGCTGCACCCACCCGCACCGCCCTCGCCCACAGTGCCCTCAGCCTGGGGCTGGCCCTGAGCCTCCTGGCCGTCATCTTAGCCCCCAGCCTGTGA
ORF Protein Sequence MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T03317-Ab Anti-LY6D/ E48/ Ly-6D monoclonal antibody
    Target Antigen GM-Tg-g-T03317-Ag LY6D VLP (virus-like particle)
    ORF Viral Vector pGMLV002718 Human LY6D Lentivirus plasmid
    ORF Viral Vector vGMLV002718 Human LY6D Lentivirus particle


    Target information

    Target ID GM-T03317
    Target Name LY6D
    Gene ID 8581, 17068, 695450, 315075, 111558518, 609112, 618714, 100063680
    Gene Symbol and Synonyms E48,Ly-61,Ly-6D,Ly61,LY6D,Thb
    Uniprot Accession Q14210
    Uniprot Entry Name LY6D_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000167656
    Target Classification Not Available

    Predicted to be involved in lymphocyte differentiation. Predicted to act upstream of or within response to stilbenoid. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in cell surface. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.