Human IL9/HP40/IL-9 ORF/cDNA clone-Adenovirus plasmid (NM_000590)

Cat. No.: pGMAP-IL-095
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL9/HP40/IL-9 adenoviral expression plasmid for IL9 adenovirus packaging, IL9 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to IL9/HP40 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-IL-095
Gene Name IL9
Accession Number NM_000590
Gene ID 3578
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 435 bp
Gene Alias HP40,IL-9,P40
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCTTCTGGCCATGGTCCTTACCTCTGCCCTGCTCCTGTGCTCCGTGGCAGGCCAGGGGTGTCCAACCTTGGCGGGGATCCTGGACATCAACTTCCTCATCAACAAGATGCAGGAAGATCCAGCTTCCAAGTGCCACTGCAGTGCTAATGTGACCAGTTGTCTCTGTTTGGGCATTCCCTCTGACAACTGCACCAGACCATGCTTCAGTGAGAGACTGTCTCAGATGACCAATACCACCATGCAAACAAGATACCCACTGATTTTCAGTCGGGTGAAAAAATCAGTTGAAGTACTAAAGAACAACAAGTGTCCATATTTTTCCTGTGAACAGCCATGCAACCAAACCACGGCAGGCAACGCGCTGACATTTCTGAAGAGTCTTCTGGAAATTTTCCAGAAAGAAAAGATGAGAGGGATGAGAGGCAAGATATGA
ORF Protein Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-185 Pre-Made Enokizumab biosimilar, Whole mAb, Anti-IL9 Antibody: Anti-HP40/IL-9/P40 therapeutic antibody
    Target Antibody GM-Tg-g-T67079-Ab Anti-IL9/ HP40/ IL-9 functional antibody
    Target Antigen GM-Tg-g-T67079-Ag IL9 protein
    ORF Viral Vector pGMLP001893 Human IL9 Lentivirus plasmid
    ORF Viral Vector pGMAP000407 Human IL9 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-012 Human IL9 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-095 Human IL9 Adenovirus plasmid
    ORF Viral Vector vGMLP001893 Human IL9 Lentivirus particle
    ORF Viral Vector vGMAP000407 Human IL9 Adenovirus particle
    ORF Viral Vector vGMLP-IL-012 Human IL9 Lentivirus particle
    ORF Viral Vector vGMAP-IL-095 Human IL9 Adenovirus particle


    Target information

    Target ID GM-T67079
    Target Name IL9
    Gene ID 3578, 16198, 712292, 116558, 101088458, 100682918, 613392, 100062710
    Gene Symbol and Synonyms HP40,IL-9,IL9,P40
    Uniprot Accession P15248
    Uniprot Entry Name IL9_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease Hodgkin's lymphoma
    Gene Ensembl ENSG00000145839
    Target Classification Not Available

    The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.