Human IL9/HP40/IL-9 ORF/cDNA clone-Adenovirus particle (BC066285)

Cat. No.: vGMAP000407

Pre-made Human IL9/HP40/IL-9 Adenovirus for IL9 overexpression in-vitro and in-vivo. The IL9 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL9-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL9/HP40 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000407 Human IL9 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000407
Gene Name IL9
Accession Number BC066285
Gene ID 3578
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 435 bp
Gene Alias HP40,IL-9,P40
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCTTCTGGCCATGGTCCTTACCTCTGCCCTGCTCCTGTGCTCCGTGGCAGGCCAGGGGTGTCCAACCTTGGCGGGGATCCTGGACATCAACTTCCTCATCAACAAGATGCAGGAAGATCCAGCTTCCAAGTGCCACTGCAGTGCTAATGTGACCAGTTGTCTCTGTTTGGGCATTCCCTCTGACAACTGCACCAGACCATGCTTCAGTGAGAGACTGTCTCAGATGACCAATACCACCATGCAAACAAGATACCCACTGATTTTCAGTCGGGTGAAAAAATCAGTTGAAGTACTAAAGAACAACAAGTGTCCATATTTTTCCTGTGAACAGCCATGCAACCAAACCACGGCAGGCAACGCGCTGACATTTCTGAAGAGTCTTCTGGAAATTTTCCAGAAAGAAAAGATGAGAGGGATGAGAGGCAAGATATGA
ORF Protein Sequence MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-185 Pre-Made Enokizumab biosimilar, Whole mAb, Anti-IL9 Antibody: Anti-HP40/IL-9/P40 therapeutic antibody
    Target Antibody GM-Tg-g-T67079-Ab Anti-IL9/ HP40/ IL-9 functional antibody
    Target Antigen GM-Tg-g-T67079-Ag IL9 protein
    ORF Viral Vector pGMLP001893 Human IL9 Lentivirus plasmid
    ORF Viral Vector pGMAP000407 Human IL9 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-012 Human IL9 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-095 Human IL9 Adenovirus plasmid
    ORF Viral Vector vGMLP001893 Human IL9 Lentivirus particle
    ORF Viral Vector vGMAP000407 Human IL9 Adenovirus particle
    ORF Viral Vector vGMLP-IL-012 Human IL9 Lentivirus particle
    ORF Viral Vector vGMAP-IL-095 Human IL9 Adenovirus particle


    Target information

    Target ID GM-T67079
    Target Name IL9
    Gene ID 3578, 16198, 712292, 116558, 101088458, 100682918, 613392, 100062710
    Gene Symbol and Synonyms HP40,IL-9,IL9,P40
    Uniprot Accession P15248
    Uniprot Entry Name IL9_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease Hodgkin's lymphoma
    Gene Ensembl ENSG00000145839
    Target Classification Not Available

    The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.