Human IL31/IL-31 ORF/cDNA clone-Adenovirus plasmid (NM_001014336)
Cat. No.: pGMAP-IL-118
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL31/IL-31 adenoviral expression plasmid for IL31 adenovirus packaging, IL31 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL31/IL-31 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP-IL-118 |
| Gene Name | IL31 |
| Accession Number | NM_001014336 |
| Gene ID | 386653 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 495 bp |
| Gene Alias | IL-31 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGCCTCTCACTCAGGCCCCTCGACGTCTGTGCTCTTTCTGTTCTGCTGCCTGGGAGGCTGGCTGGCCTCCCACACGTTGCCCGTCCGTTTACTACGACCAAGTGATGATGTACAGAAAATAGTCGAGGAATTACAGTCCCTCTCGAAGATGCTTTTGAAAGATGTGGAGGAAGAGAAGGGCGTGCTCGTGTCCCAGAATTACACGCTGCCGTGTCTCAGCCCTGACGCCCAGCCGCCAAACAACATCCACAGCCCAGCCATCCGGGCATATCTCAAGACAATCAGACAGCTAGACAACAAATCTGTTATTGATGAGATCATAGAGCACCTCGACAAACTCATATTTCAAGATGCACCAGAAACAAACATTTCTGTGCCAACAGACACCCATGAATGTAAACGCTTCATCCTGACTATTTCTCAACAGTTTTCAGAGTGCATGGACCTCGCACTAAAATCATTGACCTCTGGAGCCCAACAGGCCACCACTTAA |
| ORF Protein Sequence | MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-319 | Pre-Made Lokivetmab biosimilar, Canine Whole Mab: Anti-IL31 therapeutic antibody |
| Biosimilar | GMP-Bios-ab-155 | Pre-Made Dovanvetmab biosimilar, Feline Whole Mab: Anti-IL31 (Feline) therapeutic antibody |
| Target Antibody | GM-Tg-g-T11701-Ab | Anti-IL31/ IL-31 functional antibody |
| Target Antigen | GM-Tg-g-T11701-Ag | IL31 protein |
| Cytokine | cks-Tg-g-GM-T11701 | interleukin 31 (Il31) protein & antibody |
| ORF Viral Vector | pGMLP004789 | Human IL31 Lentivirus plasmid |
| ORF Viral Vector | pGMLP-IL-035 | Human IL31 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-118 | Human IL31 Adenovirus plasmid |
| ORF Viral Vector | vGMLP004789 | Human IL31 Lentivirus particle |
| ORF Viral Vector | vGMLP-IL-035 | Human IL31 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-118 | Human IL31 Adenovirus particle |
Target information
| Target ID | GM-T11701 |
| Target Name | IL31 |
| Gene ID | 386653, 76399, 701655, 690028, 105261056, 100302725, 102149194 |
| Gene Symbol and Synonyms | 1700013B14Rik,AABR07036324.1,IL-31,IL31 |
| Uniprot Accession | Q6EBC2 |
| Uniprot Entry Name | IL31_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, INN Index, Cytokine Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000204671 |
| Target Classification | Not Available |
IL31, which is made principally by activated Th2-type T cells, interacts with a heterodimeric receptor consisting of IL31RA (MIM 609510) and OSMR (MIM 601743) that is constitutively expressed on epithelial cells and keratinocytes. IL31 may be involved in the promotion of allergic skin disorders and in regulating other allergic diseases, such as asthma (Dillon et al., 2004 [PubMed 15184896]).[supplied by OMIM, Mar 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


