Human IL36A/FIL1/FIL1(EPSILON) ORF/cDNA clone-Adenovirus plasmid (NM_014440)

Cat. No.: pGMAP-IL-122
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL36A/FIL1/FIL1(EPSILON) adenoviral expression plasmid for IL36A adenovirus packaging, IL36A adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL36A/FIL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-IL-122
Gene Name IL36A
Accession Number NM_014440
Gene ID 27179
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 477 bp
Gene Alias FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAAAAAGCATTGAAAATTGACACACCTCAGCAGGGGAGCATTCAGGATATCAATCATCGGGTGTGGGTTCTTCAGGACCAGACGCTCATAGCAGTCCCGAGGAAGGACCGTATGTCTCCAGTCACTATTGCCTTAATCTCATGCCGACATGTGGAGACCCTTGAGAAAGACAGAGGGAACCCCATCTACCTGGGCCTGAATGGACTCAATCTCTGCCTGATGTGTGCTAAAGTCGGGGACCAGCCCACACTGCAGCTGAAGGAAAAGGATATAATGGATTTGTACAACCAACCCGAGCCTGTGAAGTCCTTTCTCTTCTACCACAGCCAGAGTGGCAGGAACTCCACCTTCGAGTCTGTGGCTTTCCCTGGCTGGTTCATCGCTGTCAGCTCTGAAGGAGGCTGTCCTCTCATCCTTACCCAAGAACTGGGGAAAGCCAACACTACTGACTTTGGGTTAACTATGCTGTTTTAA
ORF Protein Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1029-Ab Anti-IL36A/ FIL1/ FIL1(EPSILON) functional antibody
    Target Antigen GM-Tg-g-SE1029-Ag IL36A protein
    Cytokine cks-Tg-g-GM-SE1029 IL-1 F6 (IL36A) protein & antibody
    ORF Viral Vector pGMLP-IL-039 Human IL36A Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-122 Human IL36A Adenovirus plasmid
    ORF Viral Vector vGMLP-IL-039 Human IL36A Lentivirus particle
    ORF Viral Vector vGMAP-IL-122 Human IL36A Adenovirus particle


    Target information

    Target ID GM-SE1029
    Target Name IL36A
    Gene ID 27179, 705136, 296541
    Gene Symbol and Synonyms FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6,IL36A
    Uniprot Accession Q9UHA7
    Uniprot Entry Name IL36A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000136694
    Target Classification Not Available

    The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.