Human IL36A/FIL1/FIL1(EPSILON) ORF/cDNA clone-Adenovirus particle (NM_014440)
Cat. No.: vGMAP-IL-122
Pre-made Human IL36A/FIL1/FIL1(EPSILON) Adenovirus for IL36A overexpression in-vitro and in-vivo. The IL36A adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL36A-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
IL36A/FIL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP-IL-122 | Human IL36A Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP-IL-122 |
| Gene Name | IL36A |
| Accession Number | NM_014440 |
| Gene ID | 27179 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 477 bp |
| Gene Alias | FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGAAAAAGCATTGAAAATTGACACACCTCAGCAGGGGAGCATTCAGGATATCAATCATCGGGTGTGGGTTCTTCAGGACCAGACGCTCATAGCAGTCCCGAGGAAGGACCGTATGTCTCCAGTCACTATTGCCTTAATCTCATGCCGACATGTGGAGACCCTTGAGAAAGACAGAGGGAACCCCATCTACCTGGGCCTGAATGGACTCAATCTCTGCCTGATGTGTGCTAAAGTCGGGGACCAGCCCACACTGCAGCTGAAGGAAAAGGATATAATGGATTTGTACAACCAACCCGAGCCTGTGAAGTCCTTTCTCTTCTACCACAGCCAGAGTGGCAGGAACTCCACCTTCGAGTCTGTGGCTTTCCCTGGCTGGTTCATCGCTGTCAGCTCTGAAGGAGGCTGTCCTCTCATCCTTACCCAAGAACTGGGGAAAGCCAACACTACTGACTTTGGGTTAACTATGCTGTTTTAA |
| ORF Protein Sequence | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1029-Ab | Anti-IL36A/ FIL1/ FIL1(EPSILON) functional antibody |
| Target Antigen | GM-Tg-g-SE1029-Ag | IL36A protein |
| Cytokine | cks-Tg-g-GM-SE1029 | IL-1 F6 (IL36A) protein & antibody |
| ORF Viral Vector | pGMLP-IL-039 | Human IL36A Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-122 | Human IL36A Adenovirus plasmid |
| ORF Viral Vector | vGMLP-IL-039 | Human IL36A Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-122 | Human IL36A Adenovirus particle |
Target information
| Target ID | GM-SE1029 |
| Target Name | IL36A |
| Gene ID | 27179, 705136, 296541 |
| Gene Symbol and Synonyms | FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6,IL36A |
| Uniprot Accession | Q9UHA7 |
| Uniprot Entry Name | IL36A_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000136694 |
| Target Classification | Not Available |
The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


