Human HN1L/FLJ13092/KIAA1426 ORF/cDNA clone-Adenovirus plasmid (BC060853.1)

Cat. No.: pGMAP000109
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HN1L/FLJ13092/KIAA1426 adenoviral expression plasmid for HN1L adenovirus packaging, HN1L adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to JPT2/HN1L/FLJ13092 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000109
Gene Name HN1L
Accession Number BC060853.1
Gene ID 90861
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 573 bp
Gene Alias FLJ13092,KIAA1426,L11
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGTTCCAGGTCCCGGATAGCGAGGGCGGCCGCGCCGGCTCCAGGGCCATGAAGCCCCCAGGAGGAGAATCGAGCAATCTTTTTGGAAGTCCAGAAGAAGCTACTCCTTCCAGCAGGCCTAATAGGATGGCATCTAATATTTTTGGACCAACAGAAGAACCTCAGAACATACCCAAGAGGACAAATCCCCCAGGGGGTAAAGGAAGTGGTATCTTTGACGAATCAACCCCCGTGCAGACTCGACAGCACCTGAACCCACCTGGAGGGAAGACCAGCGACATTTTTGGGTCTCCGGTCACTGCCACTTCACGCTTGGCACACCCAAACAAACCCAAGGATCATGTTTTCTTATGTGAAGGAGAAGAACCAAAATCGGATCTTAAAGCTGCAAGGAGCATCCCGGCTGGAGCAGAGCCAGGTGAGAAAGGCAGCGCCAGAAAAGCAGGCCCCGCCAAGGAGCAGGAGCCCATGCCCACAGTCGACAGCCATGAGCCCCGGCTGGGGCCGCGGCCTCGCTCTCACAACAAGGTCCTGAACCCACCGGGAGGCAAATCCAGCATCTCCTTCTACTAA
ORF Protein Sequence MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2169-Ab Anti-JUPI2/ JPT2/ C16orf34 monoclonal antibody
    Target Antigen GM-Tg-g-MP2169-Ag JPT2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000508 Human JPT2 Lentivirus plasmid
    ORF Viral Vector pGMAP000109 Human HN1L Adenovirus plasmid
    ORF Viral Vector vGMLP000508 Human JPT2 Lentivirus particle
    ORF Viral Vector vGMAP000109 Human HN1L Adenovirus particle


    Target information

    Target ID GM-MP2169
    Target Name JPT2
    Gene ID 90861, 52009, 702283, 360492, 101084505, 100856401, 618512, 100065505
    Gene Symbol and Synonyms 2810430B18Rik,C16orf34,D17Ertd441e,HN1L,JPT2,L11,RGD1305117
    Uniprot Accession Q9H910
    Uniprot Entry Name JUPI2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000206053
    Target Classification Not Available

    Located in cytosol and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.