Human HN1L/FLJ13092/KIAA1426 ORF/cDNA clone-Adenovirus particle (BC060853.1)

Cat. No.: vGMAP000109

Pre-made Human HN1L/FLJ13092/KIAA1426 Adenovirus for HN1L overexpression in-vitro and in-vivo. The HN1L adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified HN1L-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to JPT2/HN1L/FLJ13092 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000109 Human HN1L Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000109
Gene Name HN1L
Accession Number BC060853.1
Gene ID 90861
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 573 bp
Gene Alias FLJ13092,KIAA1426,L11
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGTTCCAGGTCCCGGATAGCGAGGGCGGCCGCGCCGGCTCCAGGGCCATGAAGCCCCCAGGAGGAGAATCGAGCAATCTTTTTGGAAGTCCAGAAGAAGCTACTCCTTCCAGCAGGCCTAATAGGATGGCATCTAATATTTTTGGACCAACAGAAGAACCTCAGAACATACCCAAGAGGACAAATCCCCCAGGGGGTAAAGGAAGTGGTATCTTTGACGAATCAACCCCCGTGCAGACTCGACAGCACCTGAACCCACCTGGAGGGAAGACCAGCGACATTTTTGGGTCTCCGGTCACTGCCACTTCACGCTTGGCACACCCAAACAAACCCAAGGATCATGTTTTCTTATGTGAAGGAGAAGAACCAAAATCGGATCTTAAAGCTGCAAGGAGCATCCCGGCTGGAGCAGAGCCAGGTGAGAAAGGCAGCGCCAGAAAAGCAGGCCCCGCCAAGGAGCAGGAGCCCATGCCCACAGTCGACAGCCATGAGCCCCGGCTGGGGCCGCGGCCTCGCTCTCACAACAAGGTCCTGAACCCACCGGGAGGCAAATCCAGCATCTCCTTCTACTAA
ORF Protein Sequence MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2169-Ab Anti-JUPI2/ JPT2/ C16orf34 monoclonal antibody
    Target Antigen GM-Tg-g-MP2169-Ag JPT2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000508 Human JPT2 Lentivirus plasmid
    ORF Viral Vector pGMAP000109 Human HN1L Adenovirus plasmid
    ORF Viral Vector vGMLP000508 Human JPT2 Lentivirus particle
    ORF Viral Vector vGMAP000109 Human HN1L Adenovirus particle


    Target information

    Target ID GM-MP2169
    Target Name JPT2
    Gene ID 90861, 52009, 702283, 360492, 101084505, 100856401, 618512, 100065505
    Gene Symbol and Synonyms 2810430B18Rik,C16orf34,D17Ertd441e,HN1L,JPT2,L11,RGD1305117
    Uniprot Accession Q9H910
    Uniprot Entry Name JUPI2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000206053
    Target Classification Not Available

    Located in cytosol and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.