Human CD9/BTCC-1/DRAP-27 ORF/cDNA clone-Adenovirus plasmid (XM005253814.3)
Cat. No.: pGMAP000191
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD9/BTCC-1/DRAP-27 adenoviral expression plasmid for CD9 adenovirus packaging, CD9 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
CD9/BTCC-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000191 |
Gene Name | CD9 |
Accession Number | XM005253814.3 |
Gene ID | 928 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 750 bp |
Gene Alias | BTCC-1,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGCCGGTCAAAGGAGGCACCAAGTGCATCAAATACCTGCTGTTCGGATTTAACTTCATCTTCTGGCTTGCCGGGATTGCTGTCCTTGCCATTGGACTATGGCTCCGATTCGACTCTCAGACCAAGAGCATCTTCGAGCAAGAAACTAATAATAATAATTCCAGCTTCTACACAGGAGTCTATATTCTGATCGGAGCCGGCGCCCTCATGATGCTGGTGGGCTTCCTGGGCTGCTGCGGGGCTGTGCAGGAGTCCCAGTGCATGCTGGGACTGTTCTTCGGCTTCCTCTTGGTGATATTCGCCATTGAAATAGCTGCGGCCATCTGGGGATATTCCCACAAGGATGAGGTGATTAAGGAAGTCCAGGAGTTTTACAAGGACACCTACAACAAGCTGAAAACCAAGGATGAGCCCCAGCGGGAAACGCTGAAAGCCATCCACTATGCGGTATGTCGCCTTGGCAAAGACACCCTCCTGCGCTTTCTCCGGATTGTGTCTGCACACAGGGTGCTGACTGCACCAGACCAGTGCAAACATTCTAATCGTCTTCTTACAATTTGTTTCTCTCATCCCCATCCCTGCCTTCTCGCTGTAGTTGAACTGCTGTGGTTTGGCTGGGGGCGTGGAACAGTTTATCTCAGACATCTGCCCCAAGAAGGACGTACTCGAAACCTTCACCGTGAAGGTAAACTCAGACCAGGATCCTGGTGTCCCTGCCCCCATTGCTCTGGACAAACCCTGCAAGCATGA |
ORF Protein Sequence | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAVCRLGKDTLLRFLRIVSAHRVLTAPDQCKHSNRLLTICFSHPHPCLLAVVELLWFGWGRGTVYLRHLPQEGRTRNLHREGKLRPGSWCPCPHCSGQTLQA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T50574-Ab | Anti-CD9/ BTCC-1/ DRAP-27 monoclonal antibody |
Target Antigen | GM-Tg-g-T50574-Ag | CD9 VLP (virus-like particle) |
ORF Viral Vector | pGMAP000191 | Human CD9 Adenovirus plasmid |
ORF Viral Vector | pGMPC000682 | Human CD9 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMAP000191 | Human CD9 Adenovirus particle |
Target information
Target ID | GM-T50574 |
Target Name | CD9 |
Gene ID | 928, 12527, 712262, 24936, 493874, 611695, 280746, 100059512 |
Gene Symbol and Synonyms | BTCC-1,CD9,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29 |
Uniprot Accession | P21926 |
Uniprot Entry Name | CD9_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Immuno-oncology Target |
Disease | Cancer |
Gene Ensembl | ENSG00000010278 |
Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.