Human CD9/BTCC-1/DRAP-27 ORF/cDNA clone-Adenovirus plasmid (XM005253814.3)

Cat. No.: pGMAP000191
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD9/BTCC-1/DRAP-27 adenoviral expression plasmid for CD9 adenovirus packaging, CD9 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD9/BTCC-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000191
Gene Name CD9
Accession Number XM005253814.3
Gene ID 928
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 750 bp
Gene Alias BTCC-1,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCCGGTCAAAGGAGGCACCAAGTGCATCAAATACCTGCTGTTCGGATTTAACTTCATCTTCTGGCTTGCCGGGATTGCTGTCCTTGCCATTGGACTATGGCTCCGATTCGACTCTCAGACCAAGAGCATCTTCGAGCAAGAAACTAATAATAATAATTCCAGCTTCTACACAGGAGTCTATATTCTGATCGGAGCCGGCGCCCTCATGATGCTGGTGGGCTTCCTGGGCTGCTGCGGGGCTGTGCAGGAGTCCCAGTGCATGCTGGGACTGTTCTTCGGCTTCCTCTTGGTGATATTCGCCATTGAAATAGCTGCGGCCATCTGGGGATATTCCCACAAGGATGAGGTGATTAAGGAAGTCCAGGAGTTTTACAAGGACACCTACAACAAGCTGAAAACCAAGGATGAGCCCCAGCGGGAAACGCTGAAAGCCATCCACTATGCGGTATGTCGCCTTGGCAAAGACACCCTCCTGCGCTTTCTCCGGATTGTGTCTGCACACAGGGTGCTGACTGCACCAGACCAGTGCAAACATTCTAATCGTCTTCTTACAATTTGTTTCTCTCATCCCCATCCCTGCCTTCTCGCTGTAGTTGAACTGCTGTGGTTTGGCTGGGGGCGTGGAACAGTTTATCTCAGACATCTGCCCCAAGAAGGACGTACTCGAAACCTTCACCGTGAAGGTAAACTCAGACCAGGATCCTGGTGTCCCTGCCCCCATTGCTCTGGACAAACCCTGCAAGCATGA
ORF Protein Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAVCRLGKDTLLRFLRIVSAHRVLTAPDQCKHSNRLLTICFSHPHPCLLAVVELLWFGWGRGTVYLRHLPQEGRTRNLHREGKLRPGSWCPCPHCSGQTLQA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T50574-Ab Anti-CD9/ BTCC-1/ DRAP-27 monoclonal antibody
    Target Antigen GM-Tg-g-T50574-Ag CD9 VLP (virus-like particle)
    ORF Viral Vector pGMAP000191 Human CD9 Adenovirus plasmid
    ORF Viral Vector pGMPC000682 Human CD9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAP000191 Human CD9 Adenovirus particle


    Target information

    Target ID GM-T50574
    Target Name CD9
    Gene ID 928, 12527, 712262, 24936, 493874, 611695, 280746, 100059512
    Gene Symbol and Synonyms BTCC-1,CD9,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29
    Uniprot Accession P21926
    Uniprot Entry Name CD9_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Cancer
    Gene Ensembl ENSG00000010278
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.