Human CD9/BTCC-1/DRAP-27 ORF/cDNA clone-Adenovirus particle (XM005253814.3)

Cat. No.: vGMAP000191

Pre-made Human CD9/BTCC-1/DRAP-27 Adenovirus for CD9 overexpression in-vitro and in-vivo. The CD9 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CD9-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CD9/BTCC-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000191 Human CD9 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000191
Gene Name CD9
Accession Number XM005253814.3
Gene ID 928
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 750 bp
Gene Alias BTCC-1,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCCGGTCAAAGGAGGCACCAAGTGCATCAAATACCTGCTGTTCGGATTTAACTTCATCTTCTGGCTTGCCGGGATTGCTGTCCTTGCCATTGGACTATGGCTCCGATTCGACTCTCAGACCAAGAGCATCTTCGAGCAAGAAACTAATAATAATAATTCCAGCTTCTACACAGGAGTCTATATTCTGATCGGAGCCGGCGCCCTCATGATGCTGGTGGGCTTCCTGGGCTGCTGCGGGGCTGTGCAGGAGTCCCAGTGCATGCTGGGACTGTTCTTCGGCTTCCTCTTGGTGATATTCGCCATTGAAATAGCTGCGGCCATCTGGGGATATTCCCACAAGGATGAGGTGATTAAGGAAGTCCAGGAGTTTTACAAGGACACCTACAACAAGCTGAAAACCAAGGATGAGCCCCAGCGGGAAACGCTGAAAGCCATCCACTATGCGGTATGTCGCCTTGGCAAAGACACCCTCCTGCGCTTTCTCCGGATTGTGTCTGCACACAGGGTGCTGACTGCACCAGACCAGTGCAAACATTCTAATCGTCTTCTTACAATTTGTTTCTCTCATCCCCATCCCTGCCTTCTCGCTGTAGTTGAACTGCTGTGGTTTGGCTGGGGGCGTGGAACAGTTTATCTCAGACATCTGCCCCAAGAAGGACGTACTCGAAACCTTCACCGTGAAGGTAAACTCAGACCAGGATCCTGGTGTCCCTGCCCCCATTGCTCTGGACAAACCCTGCAAGCATGA
ORF Protein Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAVCRLGKDTLLRFLRIVSAHRVLTAPDQCKHSNRLLTICFSHPHPCLLAVVELLWFGWGRGTVYLRHLPQEGRTRNLHREGKLRPGSWCPCPHCSGQTLQA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T50574-Ab Anti-CD9/ BTCC-1/ DRAP-27 monoclonal antibody
    Target Antigen GM-Tg-g-T50574-Ag CD9 VLP (virus-like particle)
    ORF Viral Vector pGMAP000191 Human CD9 Adenovirus plasmid
    ORF Viral Vector pGMPC000682 Human CD9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAP000191 Human CD9 Adenovirus particle


    Target information

    Target ID GM-T50574
    Target Name CD9
    Gene ID 928, 12527, 712262, 24936, 493874, 611695, 280746, 100059512
    Gene Symbol and Synonyms BTCC-1,CD9,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29
    Uniprot Accession P21926
    Uniprot Entry Name CD9_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Cancer
    Gene Ensembl ENSG00000010278
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.