Human ANTXR2 ORF/cDNA clone-Adenovirus plasmid (BC034001)

Cat. No.: pGMAP000277
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ANTXR2/ adenoviral expression plasmid for ANTXR2 adenovirus packaging, ANTXR2 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to ANTXR2/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000277
Gene Name ANTXR2
Accession Number BC034001
Gene ID 118429
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence AGTCGGAATGGCAGTGTTCTCTGCACTTACACTGTAAATGAAACATATACAACGAGTGTAAAACCAGTAAGTGTACAGCTTAATTCTATGCTTTGTCCTGCACCTATCCTGAATAAAGCTGGAGAAACTCTTGATGTTTCAGTGAGCTTTAATGGAGGAAAATCTGTCATTTCAGGATCATTAATTGTCACAGCCACAGAATGTTCTAACGGGATCGCAGCCATCATTGTTATTTTGGTGTTACTGCTACTCCTGGGGATCGGTTTGATGTGGTGGTTTTGGCCCCTTTGCTGCAAAGTGGTTATTAAGGATCCTCCACCACCACCCCCCCCTGCACCAAAAGAGGAGGAAGAAGAACCTTTGCCTACTAAAAAGTGGCCAACTGTGGATGCTTCCTATTATGGTGGTCGAGGGGTTGGAGGAATTAAAAGAATGGAGGTTCGTTGGGGTGATAAAGGATCTACTGAGGAAGGTGCAAGGCTAGAGAAAGCCAAAAATGCTGTGGTGAAGATTCCTGAAGAAACAGAGGAACCCATCAGGCCTAGACCACCTCGACCCAAACCCACACACCAGCCTCCTCAGACAAAATGGTACACCCCAATTAAGGGTCGTCTTGATGCTCTCTGGGCTTTGTTGAGGCGGCAGTATGACCGGGTTTCTTTGATGCGACCTCAGGAAGGAGATGAGGGCCGGTGCATAAACTTCTCCCGAGTTCCATCTCAGTAA
ORF Protein Sequence SRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIKDPPPPPPPAPKEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPEETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEGRCINFSRVPSQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0069-Ab Anti-ANTR2/ ANTXR2/ CMG-2 monoclonal antibody
    Target Antigen GM-Tg-g-MP0069-Ag ANTXR2 VLP (virus-like particle)
    ORF Viral Vector pGMLV000377 Human ANTXR2 Lentivirus plasmid
    ORF Viral Vector pGMAP000277 Human ANTXR2 Adenovirus plasmid
    ORF Viral Vector vGMLV000377 Human ANTXR2 Lentivirus particle
    ORF Viral Vector vGMAP000277 Human ANTXR2 Adenovirus particle


    Target information

    Target ID GM-MP0069
    Target Name ANTXR2
    Gene ID 118429, 71914, 696513, 305633, 101094174, 487821, 510080, 100051770
    Gene Symbol and Synonyms 2310046B19Rik,ANTXR2,cI-35,CMG-2,CMG2,HFS,ISH,JHF
    Uniprot Accession P58335
    Uniprot Entry Name ANTR2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000163297
    Target Classification Not Available

    This gene encodes a receptor for anthrax toxin. The protein binds to collagen IV and laminin, suggesting that it may be involved in extracellular matrix adhesion. Mutations in this gene cause juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.