Human ANTXR2 ORF/cDNA clone-Adenovirus particle (BC034001)
Cat. No.: vGMAP000277
Pre-made Human ANTXR2/ Adenovirus for ANTXR2 overexpression in-vitro and in-vivo. The ANTXR2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified ANTXR2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
ANTXR2/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000277 | Human ANTXR2 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000277 |
| Gene Name | ANTXR2 |
| Accession Number | BC034001 |
| Gene ID | 118429 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | bp |
| Gene Alias | |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | AGTCGGAATGGCAGTGTTCTCTGCACTTACACTGTAAATGAAACATATACAACGAGTGTAAAACCAGTAAGTGTACAGCTTAATTCTATGCTTTGTCCTGCACCTATCCTGAATAAAGCTGGAGAAACTCTTGATGTTTCAGTGAGCTTTAATGGAGGAAAATCTGTCATTTCAGGATCATTAATTGTCACAGCCACAGAATGTTCTAACGGGATCGCAGCCATCATTGTTATTTTGGTGTTACTGCTACTCCTGGGGATCGGTTTGATGTGGTGGTTTTGGCCCCTTTGCTGCAAAGTGGTTATTAAGGATCCTCCACCACCACCCCCCCCTGCACCAAAAGAGGAGGAAGAAGAACCTTTGCCTACTAAAAAGTGGCCAACTGTGGATGCTTCCTATTATGGTGGTCGAGGGGTTGGAGGAATTAAAAGAATGGAGGTTCGTTGGGGTGATAAAGGATCTACTGAGGAAGGTGCAAGGCTAGAGAAAGCCAAAAATGCTGTGGTGAAGATTCCTGAAGAAACAGAGGAACCCATCAGGCCTAGACCACCTCGACCCAAACCCACACACCAGCCTCCTCAGACAAAATGGTACACCCCAATTAAGGGTCGTCTTGATGCTCTCTGGGCTTTGTTGAGGCGGCAGTATGACCGGGTTTCTTTGATGCGACCTCAGGAAGGAGATGAGGGCCGGTGCATAAACTTCTCCCGAGTTCCATCTCAGTAA |
| ORF Protein Sequence | SRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIKDPPPPPPPAPKEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPEETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEGRCINFSRVPSQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0069-Ab | Anti-ANTR2/ ANTXR2/ CMG-2 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0069-Ag | ANTXR2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLV000377 | Human ANTXR2 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000277 | Human ANTXR2 Adenovirus plasmid |
| ORF Viral Vector | vGMLV000377 | Human ANTXR2 Lentivirus particle |
| ORF Viral Vector | vGMAP000277 | Human ANTXR2 Adenovirus particle |
Target information
| Target ID | GM-MP0069 |
| Target Name | ANTXR2 |
| Gene ID | 118429, 71914, 696513, 305633, 101094174, 487821, 510080, 100051770 |
| Gene Symbol and Synonyms | 2310046B19Rik,ANTXR2,cI-35,CMG-2,CMG2,HFS,ISH,JHF |
| Uniprot Accession | P58335 |
| Uniprot Entry Name | ANTR2_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000163297 |
| Target Classification | Not Available |
This gene encodes a receptor for anthrax toxin. The protein binds to collagen IV and laminin, suggesting that it may be involved in extracellular matrix adhesion. Mutations in this gene cause juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


