Human INHA ORF/cDNA clone-Adenovirus plasmid (BC006391)

Cat. No.: pGMAP000323
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human INHA/ adenoviral expression plasmid for INHA adenovirus packaging, INHA adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to INHA/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000323
Gene Name INHA
Accession Number BC006391
Gene ID 3623
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 1101 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGCTGCACCTACTGCTCTTCTTGCTGCTGACCCCACAGGGTGGGCACAGCTGCCAGGGGCTGGAGCTGGCCCGGGAACTTGTTCTGGCCAAGGTGAGGGCCCTGTTCTTGGATGCCTTGGGGCCCCCCGCGGTGACCAGGGAAGGTGGGGACCCTGGAGTCAGGCGGCTGCCCCGAAGACATGCCCTGGGGGGCTTCACACACAGGGGCTCTGAGCCCGAGGAAGAGGAGGATGTCTCCCAAGCCATCCTTTTCCCAGCCACAGATGCCAGCTGTGAGGACAAGTCAGCTGCCAGAGGGCTGGCCCAGGAGGCTGAGGAGGGCCTCTTCAGATACATGTTCCGGCCATCCCAGCATACACGCAGCCGCCAGGTGACTTCAGCCCAGCTGTGGTTCCACACCGGGCTGGACAGGCAGGGCACAGCAGCCTCCAATAGCTCTGAGCCCCTGCTAGGCCTGCTGGCACTGTCACCGGGAGGACCCGTGGCTGTGCCCATGTCTTTGGGCCATGCTCCCCCTCACTGGGCCGTGCTGCACCTGGCCACCTCTGCTCTCTCTCTGCTGACCCACCCCGTCCTGGTGCTGCTGCTGCGCTGTCCCCTCTGTACCTGCTCAGCCCGGCCTGAGGCCACGCCCTTCCTGGTGGCCCACACTCGGACCAGACCACCCAGTGGAGGGGAGAGAGCCCGACGCTCAACTCCCCTGATGTCCTGGCCTTGGTCTCCCTCTGCTCTGCGCCTGCTGCAGAGGCCTCCGGAGGAACCGGCTGCCCATGCCAACTGCCACAGAGTAGCACTGAACATCTCCTTCCAGGAGCTGGGCTGGGAACGGTGGATCGTGTACCCTCCCAGTTTCATCTTCCACTACTGTCATGGTGGTTGTGGGCTGCACATCCCACCAAACCTGTCCCTTCCAGTCCCTGGGGCTCCCCCTACCCCAGCCCAGCCCTACTCCTTGCTGCCAGGGGCCCAGCCCTGCTGTGCTGCTCTCCCAGGGACCATGAGGCCCCTACATGTCCGCACCACCTCGGATGGAGGTTACTCTTTCAAGTATGAGACAGTGCCCAACCTTCTCACGCAGCACTGTGCTTGTATCTAA
ORF Protein Sequence MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1032-Ab Anti-INHA functional antibody
    Target Antigen GM-Tg-g-SE1032-Ag INHA protein
    ORF Viral Vector pGMLP000475 Human INHA Lentivirus plasmid
    ORF Viral Vector pGMAP000323 Human INHA Adenovirus plasmid
    ORF Viral Vector vGMLP000475 Human INHA Lentivirus particle
    ORF Viral Vector vGMAP000323 Human INHA Adenovirus particle


    Target information

    Target ID GM-SE1032
    Target Name INHA
    Gene ID 3623, 16322, 574379, 24504, 101098000, 488540, 281254, 100034077
    Gene Symbol and Synonyms INHA
    Uniprot Accession P05111
    Uniprot Entry Name INHA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000123999
    Target Classification Not Available

    This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate multiple peptide products, including the alpha subunit of the inhibin A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Mutations in this gene may be associated with male infertility and premature ovarian failure in female human patients. [provided by RefSeq, Aug 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.