Human INHA ORF/cDNA clone-Adenovirus particle (BC006391)

Cat. No.: vGMAP000323

Pre-made Human INHA/ Adenovirus for INHA overexpression in-vitro and in-vivo. The INHA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified INHA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to INHA/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000323 Human INHA Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000323
Gene Name INHA
Accession Number BC006391
Gene ID 3623
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1101 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGCTGCACCTACTGCTCTTCTTGCTGCTGACCCCACAGGGTGGGCACAGCTGCCAGGGGCTGGAGCTGGCCCGGGAACTTGTTCTGGCCAAGGTGAGGGCCCTGTTCTTGGATGCCTTGGGGCCCCCCGCGGTGACCAGGGAAGGTGGGGACCCTGGAGTCAGGCGGCTGCCCCGAAGACATGCCCTGGGGGGCTTCACACACAGGGGCTCTGAGCCCGAGGAAGAGGAGGATGTCTCCCAAGCCATCCTTTTCCCAGCCACAGATGCCAGCTGTGAGGACAAGTCAGCTGCCAGAGGGCTGGCCCAGGAGGCTGAGGAGGGCCTCTTCAGATACATGTTCCGGCCATCCCAGCATACACGCAGCCGCCAGGTGACTTCAGCCCAGCTGTGGTTCCACACCGGGCTGGACAGGCAGGGCACAGCAGCCTCCAATAGCTCTGAGCCCCTGCTAGGCCTGCTGGCACTGTCACCGGGAGGACCCGTGGCTGTGCCCATGTCTTTGGGCCATGCTCCCCCTCACTGGGCCGTGCTGCACCTGGCCACCTCTGCTCTCTCTCTGCTGACCCACCCCGTCCTGGTGCTGCTGCTGCGCTGTCCCCTCTGTACCTGCTCAGCCCGGCCTGAGGCCACGCCCTTCCTGGTGGCCCACACTCGGACCAGACCACCCAGTGGAGGGGAGAGAGCCCGACGCTCAACTCCCCTGATGTCCTGGCCTTGGTCTCCCTCTGCTCTGCGCCTGCTGCAGAGGCCTCCGGAGGAACCGGCTGCCCATGCCAACTGCCACAGAGTAGCACTGAACATCTCCTTCCAGGAGCTGGGCTGGGAACGGTGGATCGTGTACCCTCCCAGTTTCATCTTCCACTACTGTCATGGTGGTTGTGGGCTGCACATCCCACCAAACCTGTCCCTTCCAGTCCCTGGGGCTCCCCCTACCCCAGCCCAGCCCTACTCCTTGCTGCCAGGGGCCCAGCCCTGCTGTGCTGCTCTCCCAGGGACCATGAGGCCCCTACATGTCCGCACCACCTCGGATGGAGGTTACTCTTTCAAGTATGAGACAGTGCCCAACCTTCTCACGCAGCACTGTGCTTGTATCTAA
ORF Protein Sequence MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1032-Ab Anti-INHA functional antibody
    Target Antigen GM-Tg-g-SE1032-Ag INHA protein
    ORF Viral Vector pGMLP000475 Human INHA Lentivirus plasmid
    ORF Viral Vector pGMAP000323 Human INHA Adenovirus plasmid
    ORF Viral Vector vGMLP000475 Human INHA Lentivirus particle
    ORF Viral Vector vGMAP000323 Human INHA Adenovirus particle


    Target information

    Target ID GM-SE1032
    Target Name INHA
    Gene ID 3623, 16322, 574379, 24504, 101098000, 488540, 281254, 100034077
    Gene Symbol and Synonyms INHA
    Uniprot Accession P05111
    Uniprot Entry Name INHA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000123999
    Target Classification Not Available

    This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate multiple peptide products, including the alpha subunit of the inhibin A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Mutations in this gene may be associated with male infertility and premature ovarian failure in female human patients. [provided by RefSeq, Aug 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.