Human TMEM182/FLJ30294 ORF/cDNA clone-Adenovirus plasmid (BC020898)

Cat. No.: pGMAP000417
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM182/FLJ30294 adenoviral expression plasmid for TMEM182 adenovirus packaging, TMEM182 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMEM182/FLJ30294 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000417
Gene Name TMEM182
Accession Number BC020898
Gene ID 130827
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 333 bp
Gene Alias FLJ30294
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCCTGGGGGTAGTTGCTGTAGTCATCGCAAGCTTTTTGATCATCTGTGCAGCCCCCTTCGCCAGCCATTTTCTCTACAAAGCTGGGGGAGGCTCATATATTGCTGCAGGCATCCTATTTTCATTGGTGGTGATGCTGTATGTCATCTGGGTCCAGGCAGTGGCTGACATGGAAAGCTACCGAAACATGAAAATGAAGGACTGCCTGGATTTCACCCCTTCTGTTCTGTATGGCTGGTCATTTTTCCTGGCCCCAGCTGGGATATTTTTTTCTTTGCTAGCTGGATTACTATTTCTGGTTGTTGGACGGCATATTCAGATACATCACTAA
ORF Protein Sequence MLLGVVAVVIASFLIICAAPFASHFLYKAGGGSYIAAGILFSLVVMLYVIWVQAVADMESYRNMKMKDCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGRHIQIHH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1824-Ab Anti-TM182/ TMEM182 monoclonal antibody
    Target Antigen GM-Tg-g-MP1824-Ag TMEM182 VLP (virus-like particle)
    ORF Viral Vector pGMAP000417 Human TMEM182 Adenovirus plasmid
    ORF Viral Vector vGMAP000417 Human TMEM182 Adenovirus particle


    Target information

    Target ID GM-MP1824
    Target Name TMEM182
    Gene ID 130827, 381339, 712344, 501129, 101101379, 611413, 618298, 100050144
    Gene Symbol and Synonyms 2310079P10Rik,RGD1563696,TMEM182
    Uniprot Accession Q6ZP80
    Uniprot Entry Name TM182_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000170417
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.