Human TMEM182/FLJ30294 ORF/cDNA clone-Adenovirus plasmid (BC020898)
Cat. No.: pGMAP000417
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TMEM182/FLJ30294 adenoviral expression plasmid for TMEM182 adenovirus packaging, TMEM182 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
TMEM182/FLJ30294 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000417 |
| Gene Name | TMEM182 |
| Accession Number | BC020898 |
| Gene ID | 130827 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 333 bp |
| Gene Alias | FLJ30294 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTCCTGGGGGTAGTTGCTGTAGTCATCGCAAGCTTTTTGATCATCTGTGCAGCCCCCTTCGCCAGCCATTTTCTCTACAAAGCTGGGGGAGGCTCATATATTGCTGCAGGCATCCTATTTTCATTGGTGGTGATGCTGTATGTCATCTGGGTCCAGGCAGTGGCTGACATGGAAAGCTACCGAAACATGAAAATGAAGGACTGCCTGGATTTCACCCCTTCTGTTCTGTATGGCTGGTCATTTTTCCTGGCCCCAGCTGGGATATTTTTTTCTTTGCTAGCTGGATTACTATTTCTGGTTGTTGGACGGCATATTCAGATACATCACTAA |
| ORF Protein Sequence | MLLGVVAVVIASFLIICAAPFASHFLYKAGGGSYIAAGILFSLVVMLYVIWVQAVADMESYRNMKMKDCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGRHIQIHH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP1824-Ab | Anti-TM182/ TMEM182 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP1824-Ag | TMEM182 VLP (virus-like particle) |
| ORF Viral Vector | pGMAP000417 | Human TMEM182 Adenovirus plasmid |
| ORF Viral Vector | vGMAP000417 | Human TMEM182 Adenovirus particle |
Target information
| Target ID | GM-MP1824 |
| Target Name | TMEM182 |
| Gene ID | 130827, 381339, 712344, 501129, 101101379, 611413, 618298, 100050144 |
| Gene Symbol and Synonyms | 2310079P10Rik,RGD1563696,TMEM182 |
| Uniprot Accession | Q6ZP80 |
| Uniprot Entry Name | TM182_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000170417 |
| Target Classification | Not Available |
Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


