Human TMEM182/FLJ30294 ORF/cDNA clone-Adenovirus particle (BC020898)

Cat. No.: vGMAP000417

Pre-made Human TMEM182/FLJ30294 Adenovirus for TMEM182 overexpression in-vitro and in-vivo. The TMEM182 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TMEM182-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TMEM182/FLJ30294 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000417 Human TMEM182 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000417
Gene Name TMEM182
Accession Number BC020898
Gene ID 130827
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 333 bp
Gene Alias FLJ30294
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCCTGGGGGTAGTTGCTGTAGTCATCGCAAGCTTTTTGATCATCTGTGCAGCCCCCTTCGCCAGCCATTTTCTCTACAAAGCTGGGGGAGGCTCATATATTGCTGCAGGCATCCTATTTTCATTGGTGGTGATGCTGTATGTCATCTGGGTCCAGGCAGTGGCTGACATGGAAAGCTACCGAAACATGAAAATGAAGGACTGCCTGGATTTCACCCCTTCTGTTCTGTATGGCTGGTCATTTTTCCTGGCCCCAGCTGGGATATTTTTTTCTTTGCTAGCTGGATTACTATTTCTGGTTGTTGGACGGCATATTCAGATACATCACTAA
ORF Protein Sequence MLLGVVAVVIASFLIICAAPFASHFLYKAGGGSYIAAGILFSLVVMLYVIWVQAVADMESYRNMKMKDCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGRHIQIHH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1824-Ab Anti-TM182/ TMEM182 monoclonal antibody
    Target Antigen GM-Tg-g-MP1824-Ag TMEM182 VLP (virus-like particle)
    ORF Viral Vector pGMAP000417 Human TMEM182 Adenovirus plasmid
    ORF Viral Vector vGMAP000417 Human TMEM182 Adenovirus particle


    Target information

    Target ID GM-MP1824
    Target Name TMEM182
    Gene ID 130827, 381339, 712344, 501129, 101101379, 611413, 618298, 100050144
    Gene Symbol and Synonyms 2310079P10Rik,RGD1563696,TMEM182
    Uniprot Accession Q6ZP80
    Uniprot Entry Name TM182_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000170417
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.