Human KLRF1/CLEC5C/NKp80 ORF/cDNA clone-Lentivirus plasmid (NM_016523)

Cat. No.: pGMLV000975
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KLRF1/CLEC5C/NKp80 Lentiviral expression plasmid for KLRF1 lentivirus packaging, KLRF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to KLRF1/CLEC5C products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $474
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000975
Gene Name KLRF1
Accession Number NM_016523
Gene ID 51348
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 696 bp
Gene Alias CLEC5C,NKp80
Fluorescent Reporter EGFP
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAAGATGAAGAAAGATACATGACATTGAATGTACAGTCAAAGAAAAGGAGTTCTGCCCAAACATCTCAACTTACATTTAAAGATTATTCAGTGACGTTGCACTGGTATAAAATCTTACTGGGAATATCTGGAACCGTGAATGGTATTCTCACTTTGACTTTGATCTCCTTGATCCTGTTGGTTTCTCAGGGAGTATTGCTAAAATGCCAAAAAGGAAGTTGTTCAAATGCCACTCAGTATGAGGACACTGGAGATCTAAAAGTGAATAATGGCACAAGAAGAAATATAAGTAATAAGGACCTTTGTGCTTCGAGATCTGCAGACCAGACAGTACTATGCCAATCAGAATGGCTCAAATACCAAGGGAAGTGTTATTGGTTCTCTAATGAGATGAAAAGCTGGAGTGACAGTTATGTGTATTGTTTGGAAAGAAAATCTCATCTACTAATCATACATGACCAACTTGAAATGGCTTTTATACAGAAAAACCTAAGACAATTAAACTACGTATGGATTGGGCTTAACTTTACCTCCTTGAAAATGACATGGACTTGGGTGGATGGTTCTCCAATAGATTCAAAGATATTCTTCATAAAGGGACCAGCTAAAGAAAACAGCTGTGCTGCCATTAAGGAAAGCAAAATTTTCTCTGAAACCTGCAGCAGTGTTTTCAAATGGATTTGTCAGTATTAG
ORF Protein Sequence MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0714-Ab Anti-KLRF1/ CLEC5C/ NKp80 monoclonal antibody
    Target Antigen GM-Tg-g-MP0714-Ag KLRF1 VLP (virus-like particle)
    ORF Viral Vector pGMLV000975 Human KLRF1 Lentivirus plasmid
    ORF Viral Vector vGMLV000975 Human KLRF1 Lentivirus particle


    Target information

    Target ID GM-MP0714
    Target Name KLRF1
    Gene ID 51348, 574389, 101082756, 611429, 100062092
    Gene Symbol and Synonyms CLEC5C,KLRF1,NKp80
    Uniprot Accession Q9NZS2
    Uniprot Entry Name KLRF1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000150045
    Target Classification Not Available

    KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release (Kuttruff et al., 2009 [PubMed 18922855]).[supplied by OMIM, Oct 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.