Human RAB23/HSPC137 ORF/cDNA clone-Lentivirus plasmid (NM_183227.3)

Cat. No.: pGMLV001898
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAB23/HSPC137 Lentiviral expression plasmid for RAB23 lentivirus packaging, RAB23 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RAB23/HSPC137 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $478.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001898
Gene Name RAB23
Accession Number NM_183227.3
Gene ID 51715
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 714 bp
Gene Alias HSPC137
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGGAGGAAGATATGGAAGTCGCCATAAAGATGGTGGTTGTAGGGAATGGAGCAGTTGGAAAATCAAGTATGATTCAGCGATATTGCAAAGGCATTTTTACAAAAGACTACAAGAAAACCATTGGAGTTGATTTTTTGGAGCGACAAATTCAAGTTAATGATGAAGATGTCAGACTAATGTTATGGGACACTGCAGGTCAGGAGGAATTTGATGCAATTACAAAGGCCTACTATCGAGGAGCCCAGGCTTGTGTGCTCGTGTTCTCTACCACAGATAGGGAATCTTTTGAAGCAGTTTCCAGTTGGAGAGAGAAAGTAGTAGCCGAAGTGGGAGATATACCAACTGTACTTGTGCAAAACAAGATTGATCTTCTGGATGATTCTTGTATAAAGAATGAGGAAGCTGAGGCACTGGCAAAAAGGTTAAAGTTAAGATTCTACAGAACATCAGTGAAAGAAGATCTAAATGTGAATGAAGTTTTTAAGTATTTGGCTGAAAAATACCTTCAGAAACTCAAACAACAAATAGCTGAGGATCCAGAACTAACGCATTCAAGTAGTAACAAGATTGGTGTCTTTAATACATCTGGTGGAAGTCACTCCGGTCAGAATTCAGGTACCCTCAATGGTGGAGATGTCATCAATCTTAGACCCAACAAACAAAGGACCAAGAAAAACAGAAATCCTTTTAGCAGCTGTAGCATACCCTAA
ORF Protein Sequence MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2274-Ab Anti-RAB23/ HSPC137 monoclonal antibody
    Target Antigen GM-Tg-g-MP2274-Ag RAB23 VLP (virus-like particle)
    ORF Viral Vector pGMLP000222 Human RAB23 Lentivirus plasmid
    ORF Viral Vector pGMLV001898 Human RAB23 Lentivirus plasmid
    ORF Viral Vector vGMLP000222 Human RAB23 Lentivirus particle
    ORF Viral Vector vGMLV001898 Human RAB23 Lentivirus particle


    Target information

    Target ID GM-MP2274
    Target Name RAB23
    Gene ID 51715, 19335, 712860, 367242, 101100469, 481854, 618588, 100070075
    Gene Symbol and Synonyms HSPC137,opb,opb2,rab-15,RAB23,Rab23-like
    Uniprot Accession Q9ULC3
    Uniprot Entry Name RAB23_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000112210
    Target Classification Not Available

    This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.