Human OLR1/CLEC8A/LOX1 ORF/cDNA clone-Lentivirus plasmid (NM_002543.4)
Cat. No.: pGMLV002554
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human OLR1/CLEC8A/LOX1 Lentiviral expression plasmid for OLR1 lentivirus packaging, OLR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
OLR1/CLEC8A products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV002554 |
Gene Name | OLR1 |
Accession Number | NM_002543.4 |
Gene ID | 4973 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 822 bp |
Gene Alias | CLEC8A,LOX1,LOXIN,SCARE1,SLOX1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTTTTGATGACCTAAAGATCCAGACTGTGAAGGACCAGCCTGATGAGAAGTCAAATGGAAAAAAAGCTAAAGGTCTTCAGTTTCTTTACTCTCCATGGTGGTGCCTGGCTGCTGCGACTCTAGGGGTCCTTTGCCTGGGATTAGTAGTGACCATTATGGTGCTGGGCATGCAATTATCCCAGGTGTCTGACCTCCTAACACAAGAGCAAGCAAACCTAACTCACCAGAAAAAGAAACTGGAGGGACAGATCTCAGCCCGGCAACAAGCAGAAGAAGCTTCACAGGAGTCAGAAAACGAACTCAAGGAAATGATAGAAACCCTTGCTCGGAAGCTGAATGAGAAATCCAAAGAGCAAATGGAACTTCACCACCAGAATCTGAATCTCCAAGAAACACTGAAGAGAGTAGCAAATTGTTCAGCTCCTTGTCCGCAAGACTGGATCTGGCATGGAGAAAACTGTTACCTATTTTCCTCGGGCTCATTTAACTGGGAAAAGAGCCAAGAGAAGTGCTTGTCTTTGGATGCCAAGTTGCTGAAAATTAATAGCACAGCTGATCTGGACTTCATCCAGCAAGCAATTTCCTATTCCAGTTTTCCATTCTGGATGGGGCTGTCTCGGAGGAACCCCAGCTACCCATGGCTCTGGGAGGACGGTTCTCCTTTGATGCCCCACTTATTTAGAGTCCGAGGCGCTGTCTCCCAGACATACCCTTCAGGTACCTGTGCATATATACAACGAGGAGCTGTTTATGCGGAAAACTGCATTTTAGCTGCCTTCAGTATATGTCAGAAGAAGGCAAACCTAAGAGCACAGTGA |
ORF Protein Sequence | MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T49630-Ab | Anti-OLR1/ CLEC8A/ LOX1 monoclonal antibody |
Target Antigen | GM-Tg-g-T49630-Ag | OLR1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000723 | Human OLR1 Lentivirus plasmid |
ORF Viral Vector | pGMLV002554 | Human OLR1 Lentivirus plasmid |
ORF Viral Vector | pGMPC001398 | Human OLR1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001400 | Human OLR1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000723 | Human OLR1 Lentivirus particle |
ORF Viral Vector | vGMLV002554 | Human OLR1 Lentivirus particle |
Target information
Target ID | GM-T49630 |
Target Name | OLR1 |
Gene ID | 4973, 108078, 717596, 140914, 101086238, 486694, 281368, 100062370 |
Gene Symbol and Synonyms | CLEC8A,LOX-1,LOX1,LOXIN,Oldlr1,Oldr1,OLR1,SCARE1,SLOX1,SR-EI |
Uniprot Accession | P78380 |
Uniprot Entry Name | OLR1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000173391 |
Target Classification | Not Available |
This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.