Human FKBP3/FKBP-25/PPIase ORF/cDNA clone-Adenovirus particle (BC016288)

Cat. No.: vGMAP000352

Pre-made Human FKBP3/FKBP-25/PPIase Adenovirus for FKBP3 overexpression in-vitro and in-vivo. The FKBP3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FKBP3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000352 Human FKBP3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000352
Gene Name FKBP3
Accession Number BC016288
Gene ID 2287
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 675 bp
Gene Alias FKBP-25,PPIase
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCCGTTCCACAGCGGGCGTGGACCGTGGAGCAGCTGCGCAGTGAGCAGCTGCCCAAGAAGGACATTATCAAGTTTCTGCAGGAACACGGTTCAGATTCGTTTCTTGCAGAACATAAATTATTAGGAAACATTAAAAATGTGGCCAAGACAGCTAACAAGGACCACTTGGTTACAGCCTATAACCATCTTTTTGAAACTAAGCGTTTTAAGGGTACTGAAAGTATAAGTAAAGTGTCTGAGCAAGTAAAAAATGTGAAGCTTAATGAAGATAAACCCAAAGAAACCAAGTCTGAAGAGACCCTGGATGAGGGTCCACCAAAATATACTAAATCTGTTCTGAAAAAGGGAGATAAAACCAACTTTCCCAAAAAGGGAGATGTTGTTCACTGCTGGTATACAGGAACACTACAAGATGGGACTGTTTTTGATACTAATATTCAAACAAGTGCAAAGAAGAAGAAAAATGCCAAGCCTTTAAGTTTTAAGGTCGGAGTAGGCAAAGTTATCAGAGGATGGGATGAAGCTCTCTTGACTATGAGTAAAGGAGAAAAGGCTCGACTGGAGATTGAACCAGAATGGGCTTACGGAAAGAAAGGACAGCCTGATGCCAAAATTCCACCAAATGCAAAACTCACTTTTGAAGTGGAATTAGTGGATATTGATTGA
ORF Protein Sequence MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector pGMAP000352 Human FKBP3 Adenovirus plasmid




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.