Human SOD2/IPO-B/Mn-SOD ORF/cDNA clone-Adenovirus particle (BC012423)
Cat. No.: vGMAP000391
Pre-made Human SOD2/IPO-B/Mn-SOD Adenovirus for SOD2 overexpression in-vitro and in-vivo. The SOD2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SOD2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
SOD Mn/SOD2/IPO-B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000391 | Human SOD2 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000391 |
| Gene Name | SOD2 |
| Accession Number | BC012423 |
| Gene ID | 6648 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 669 bp |
| Gene Alias | IPO-B,Mn-SOD,MNSOD |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTTGAGCCGGGCAGTGTGCGGCACCAGCAGGCAGCTGGCTCCGGTTTTGGGGTATCTGGGCTCCAGGCAGAAGCACAGCCTCCCCGACCTGCCCTACGACTACGGCGCCCTGGAACCTCACATCAACGCGCAGATCATGCAGCTGCACCACAGCAAGCACCACGCGGCCTACGTGAACAACCTGAACGTCACCGAGGAGAAGTACCAGGAGGCGTTGGCCAAGGGAGATGTTACAGCCCAGATAGCTCTTCAGCCTGCACTGAAGTTCAATGGTGGTGGTCATATCAATCATAGCATTTTCTGGACAAACCTCAGCCCTAACGGTGGTGGAGAACCCAAAGGGGAGTTGCTGGAAGCCATCAAACGTGACTTTGGTTCCTTTGACAAGTTTAAGGAGAAGCTGACGGCTGCATCTGTTGGTGTCCAAGGCTCAGGTTGGGGTTGGCTTGGTTTCAATAAGGAACGGGGACACTTACAAATTGCTGCTTGTCCAAATCAGGATCCACTGCAAGGAACAACAGGCCTTATTCCACTGCTGGGGATTGATGTGTGGGAGCACGCTTACTACCTTCAGTATAAAAATGTCAGGCCTGATTATCTAAAAGCTATTTGGAATGTAATCAACTGGGAGAATGTAACTGAAAGATACATGGCTTGCAAAAAGTAA |
| ORF Protein Sequence | MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T89147-Ab | Anti-SOD Mn monoclonal antibody |
| Target Antigen | GM-Tg-g-T89147-Ag | SOD Mn/SOD2 protein |
| ORF Viral Vector | pGMLV001195 | Human SOD2 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001938 | Human SOD2 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002692 | Human SOD2 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000363 | Human SOD2 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000391 | Human SOD2 Adenovirus plasmid |
| ORF Viral Vector | vGMLV001195 | Human SOD2 Lentivirus particle |
| ORF Viral Vector | vGMLV001938 | Human SOD2 Lentivirus particle |
| ORF Viral Vector | vGMLV002692 | Human SOD2 Lentivirus particle |
| ORF Viral Vector | vGMAAV000363 | Human SOD2 Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000391 | Human SOD2 Adenovirus particle |
Target information
| Target ID | GM-T89147 |
| Target Name | SOD Mn |
| Gene ID | 6648, 20656, 574097, 24787, 101096985, 476258, 281496, 100034223 |
| Gene Symbol and Synonyms | GC1,GClnc1,IPO-B,IPOB,Mn-SOD,MNSOD,MVCD6,Sod-2,SOD2,SOD2X1,SOD2X2 |
| Uniprot Accession | P04179 |
| Uniprot Entry Name | SODM_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000112096 |
| Target Classification | Tumor-associated antigen (TAA) |
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. [provided by RefSeq, Apr 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


