Human RNASEH2C/AGS3/AYP1 ORF/cDNA clone-Adenovirus particle (BC023588)

Cat. No.: vGMAP000510

Pre-made Human RNASEH2C/AGS3/AYP1 Adenovirus for RNASEH2C overexpression in-vitro and in-vivo. The RNASEH2C adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified RNASEH2C-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to RNASEH2C/AGS3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000510 Human RNASEH2C Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000510
Gene Name RNASEH2C
Accession Number BC023588
Gene ID 84153
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 495 bp
Gene Alias AGS3,AYP1,FLJ20974,MGC22934
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGAGCGGCGACGAAGCGGCCATCGAGAGGCACCGCGTCCACTTGCGCTCCGCCACATTGCGCGACGCCGTACCCGCCACACTGCATCTGCTGCCCTGCGAGGTTGCGGTGGACGGGCCCGCCCCGGTGGGGCGCTTCTTCACGCCCGCCATCCGCCAGGGCCCCGAGGGACTCGAAGTGTCGTTTCGGGGCCGCTGTCTACGGGGAGAGGAGGTGGCGGTGCCGCCTGGCCTCGTGGGATACGTGATGGTGACAGAAGAGAAGAAGGTGTCGATGGGGAAGCCAGACCCCTTGCGGGATTCCGGGACTGACGACCAAGAGGAGGAGCCGCTGGAGCGGGACTTCGACCGCTTCATTGGAGCCACTGCCAACTTCAGCCGCTTCACCCTGTGGGGTCTGGAGACCATCCCTGGCCCGGATGCCAAAGTGCGTGGGGCCTTAACTTGGCCCAGCCTTGCGGCAGCGATTCACGCACAGGTGCCCGAGGACTGA
ORF Protein Sequence MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA154-Ab Anti-RNASEH2C monoclonal antibody
    Target Antigen GM-Tg-g-TA154-Ag RNASEH2C protein
    ORF Viral Vector pGMAP000510 Human RNASEH2C Adenovirus plasmid
    ORF Viral Vector vGMAP000510 Human RNASEH2C Adenovirus particle


    Target information

    Target ID GM-TA154
    Target Name RNASEH2C
    Gene ID 84153, 68209, 700330, 100361939, 101100003, 610886, 505618, 100057522
    Gene Symbol and Synonyms 1500026D16Rik,AGS3,AYP1,RNASEH2C
    Uniprot Accession Q8TDP1
    Uniprot Entry Name RNH2C_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000172922
    Target Classification Not Available

    This gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identified on chromosome Y, near the sex determining region Y (SRY) gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.