Human ATG3/APG3/APG3-LIKE ORF/cDNA clone-Lentivirus particle (NM_022488)

Cat. No.: vGMLP-atg-018

Pre-made Human ATG3/APG3/APG3-LIKE Lentiviral expression plasmid for ATG3 lentivirus packaging, ATG3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ATG3/APG3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-atg-018 Human ATG3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-atg-018
Gene Name ATG3
Accession Number NM_022488
Gene ID 64422
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 945 bp
Gene Alias APG3,APG3-LIKE,APG3L,PC3-96
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGAATGTGATTAATACTGTGAAGGGAAAGGCACTGGAAGTGGCTGAGTACCTGACCCCGGTCCTCAAGGAATCAAAGTTTAAGGAAACAGGTGTAATTACCCCAGAAGAGTTTGTGGCAGCTGGAGATCACCTAGTCCACCACTGTCCAACATGGCAATGGGCTACAGGGGAAGAATTGAAAGTGAAGGCATACCTACCAACAGGCAAACAATTTTTGGTAACCAAAAATGTGCCGTGCTATAAGCGGTGCAAACAGATGGAATATTCAGATGAATTGGAAGCTATCATTGAAGAAGATGATGGTGATGGCGGATGGGTAGATACATATCACAACACAGGTATTACAGGAATAACGGAAGCCGTTAAAGAGATCACACTGGAAAATAAGGACAATATAAGGCTTCAAGATTGCTCAGCACTATGTGAAGAGGAAGAAGATGAAGATGAAGGAGAAGCTGCAGATATGGAAGAATATGAAGAGAGTGGATTGTTGGAAACAGATGAGGCTACCCTAGATACAAGGAAAATAGTAGAAGCTTGTAAAGCCAAAACTGATGCTGGCGGTGAAGATGCTATTTTGCAAACCAGAACTTATGACCTTTACATCACTTATGATAAATATTACCAGACTCCACGATTATGGTTGTTTGGCTATGATGAGCAACGGCAGCCTTTAACAGTTGAGCACATGTATGAAGACATCAGTCAGGATCATGTGAAGAAAACAGTGACCATTGAAAATCACCCTCATCTGCCACCACCTCCCATGTGTTCAGTTCACCCATGCAGGCATGCTGAGGTGATGAAGAAAATCATTGAGACTGTTGCAGAAGGAGGGGGAGAACTTGGAGTTCATATGTATCTTCTTATTTTCTTGAAATTTGTACAAGCTGTCATTCCAACAATAGAATATGACTACACAAGACACTTCACAATGTAA
ORF Protein Sequence MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2365-Ab Anti-ATG3 monoclonal antibody
    Target Antigen GM-Tg-g-IP2365-Ag ATG3 protein
    ORF Viral Vector pGMLP002036 Human ATG3 Lentivirus plasmid
    ORF Viral Vector pGMLP-atg-018 Human ATG3 Lentivirus plasmid
    ORF Viral Vector pGMAP-atg-072 Human ATG3 Adenovirus plasmid
    ORF Viral Vector pGMPC001561 Human ATG3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002036 Human ATG3 Lentivirus particle
    ORF Viral Vector vGMLP-atg-018 Human ATG3 Lentivirus particle
    ORF Viral Vector vGMAP-atg-072 Human ATG3 Adenovirus particle


    Target information

    Target ID GM-IP2365
    Target Name ATG3
    Gene ID 64422, 67841, 708305, 171415, 101088607, 478564, 508571, 100061410
    Gene Symbol and Synonyms 2610016C12Rik,APG3,APG3-LIKE,APG3L,ATG3,Atg3l,hApg3,PC3-96,PIG-1,Pig1
    Uniprot Accession Q9NT62
    Uniprot Entry Name ATG3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000144848
    Target Classification Not Available

    This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.