Human ATG3/APG3/APG3-LIKE ORF/cDNA clone-Lentivirus particle (NM_022488)
Cat. No.: vGMLP002036
Pre-made Human ATG3/APG3/APG3-LIKE Lentiviral expression plasmid for ATG3 lentivirus packaging, ATG3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
ATG3/APG3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002036 | Human ATG3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002036 |
Gene Name | ATG3 |
Accession Number | NM_022488 |
Gene ID | 64422 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 945 bp |
Gene Alias | APG3,APG3-LIKE,APG3L,PC3-96 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGAATGTGATTAATACTGTGAAGGGAAAGGCACTGGAAGTGGCTGAGTACCTGACCCCGGTCCTCAAGGAATCAAAGTTTAAGGAAACAGGTGTAATTACCCCAGAAGAGTTTGTGGCAGCTGGAGATCACCTAGTCCACCACTGTCCAACATGGCAATGGGCTACAGGGGAAGAATTGAAAGTGAAGGCATACCTACCAACAGGCAAACAATTTTTGGTAACCAAAAATGTGCCGTGCTATAAGCGGTGCAAACAGATGGAATATTCAGATGAATTGGAAGCTATCATTGAAGAAGATGATGGTGATGGCGGATGGGTAGATACATATCACAACACAGGTATTACAGGAATAACGGAAGCCGTTAAAGAGATCACACTGGAAAATAAGGACAATATAAGGCTTCAAGATTGCTCAGCACTATGTGAAGAGGAAGAAGATGAAGATGAAGGAGAAGCTGCAGATATGGAAGAATATGAAGAGAGTGGATTGTTGGAAACAGATGAGGCTACCCTAGATACAAGGAAAATAGTAGAAGCTTGTAAAGCCAAAACTGATGCTGGCGGTGAAGATGCTATTTTGCAAACCAGAACTTATGACCTTTACATCACTTATGATAAATATTACCAGACTCCACGATTATGGTTGTTTGGCTATGATGAGCAACGGCAGCCTTTAACAGTTGAGCACATGTATGAAGACATCAGTCAGGATCATGTGAAGAAAACAGTGACCATTGAAAATCACCCTCATCTGCCACCACCTCCCATGTGTTCAGTTCACCCATGCAGGCATGCTGAGGTGATGAAGAAAATCATTGAGACTGTTGCAGAAGGAGGGGGAGAACTTGGAGTTCATATGTATCTTCTTATTTTCTTGAAATTTGTACAAGCTGTCATTCCAACAATAGAATATGACTACACAAGACACTTCACAATGTAA |
ORF Protein Sequence | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2365-Ab | Anti-ATG3 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2365-Ag | ATG3 protein |
ORF Viral Vector | pGMLP002036 | Human ATG3 Lentivirus plasmid |
ORF Viral Vector | pGMLP-atg-018 | Human ATG3 Lentivirus plasmid |
ORF Viral Vector | pGMAP-atg-072 | Human ATG3 Adenovirus plasmid |
ORF Viral Vector | pGMPC001561 | Human ATG3 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP002036 | Human ATG3 Lentivirus particle |
ORF Viral Vector | vGMLP-atg-018 | Human ATG3 Lentivirus particle |
ORF Viral Vector | vGMAP-atg-072 | Human ATG3 Adenovirus particle |
Target information
Target ID | GM-IP2365 |
Target Name | ATG3 |
Gene ID | 64422, 67841, 708305, 171415, 101088607, 478564, 508571, 100061410 |
Gene Symbol and Synonyms | 2610016C12Rik,APG3,APG3-LIKE,APG3L,ATG3,Atg3l,hApg3,PC3-96,PIG-1,Pig1 |
Uniprot Accession | Q9NT62 |
Uniprot Entry Name | ATG3_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000144848 |
Target Classification | Not Available |
This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.