Human ATG3/APG3/APG3-LIKE ORF/cDNA clone-Adenovirus particle (NM_022488)

Cat. No.: vGMAP-atg-072

Pre-made Human ATG3/APG3/APG3-LIKE Adenovirus for ATG3 overexpression in-vitro and in-vivo. The ATG3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified ATG3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to ATG3/APG3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-atg-072 Human ATG3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-atg-072
Gene Name ATG3
Accession Number NM_022488
Gene ID 64422
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 945 bp
Gene Alias APG3,APG3-LIKE,APG3L,PC3-96
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGAATGTGATTAATACTGTGAAGGGAAAGGCACTGGAAGTGGCTGAGTACCTGACCCCGGTCCTCAAGGAATCAAAGTTTAAGGAAACAGGTGTAATTACCCCAGAAGAGTTTGTGGCAGCTGGAGATCACCTAGTCCACCACTGTCCAACATGGCAATGGGCTACAGGGGAAGAATTGAAAGTGAAGGCATACCTACCAACAGGCAAACAATTTTTGGTAACCAAAAATGTGCCGTGCTATAAGCGGTGCAAACAGATGGAATATTCAGATGAATTGGAAGCTATCATTGAAGAAGATGATGGTGATGGCGGATGGGTAGATACATATCACAACACAGGTATTACAGGAATAACGGAAGCCGTTAAAGAGATCACACTGGAAAATAAGGACAATATAAGGCTTCAAGATTGCTCAGCACTATGTGAAGAGGAAGAAGATGAAGATGAAGGAGAAGCTGCAGATATGGAAGAATATGAAGAGAGTGGATTGTTGGAAACAGATGAGGCTACCCTAGATACAAGGAAAATAGTAGAAGCTTGTAAAGCCAAAACTGATGCTGGCGGTGAAGATGCTATTTTGCAAACCAGAACTTATGACCTTTACATCACTTATGATAAATATTACCAGACTCCACGATTATGGTTGTTTGGCTATGATGAGCAACGGCAGCCTTTAACAGTTGAGCACATGTATGAAGACATCAGTCAGGATCATGTGAAGAAAACAGTGACCATTGAAAATCACCCTCATCTGCCACCACCTCCCATGTGTTCAGTTCACCCATGCAGGCATGCTGAGGTGATGAAGAAAATCATTGAGACTGTTGCAGAAGGAGGGGGAGAACTTGGAGTTCATATGTATCTTCTTATTTTCTTGAAATTTGTACAAGCTGTCATTCCAACAATAGAATATGACTACACAAGACACTTCACAATGTAA
ORF Protein Sequence MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2365-Ab Anti-ATG3 monoclonal antibody
    Target Antigen GM-Tg-g-IP2365-Ag ATG3 protein
    ORF Viral Vector pGMLP002036 Human ATG3 Lentivirus plasmid
    ORF Viral Vector pGMLP-atg-018 Human ATG3 Lentivirus plasmid
    ORF Viral Vector pGMAP-atg-072 Human ATG3 Adenovirus plasmid
    ORF Viral Vector pGMPC001561 Human ATG3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002036 Human ATG3 Lentivirus particle
    ORF Viral Vector vGMLP-atg-018 Human ATG3 Lentivirus particle
    ORF Viral Vector vGMAP-atg-072 Human ATG3 Adenovirus particle


    Target information

    Target ID GM-IP2365
    Target Name ATG3
    Gene ID 64422, 67841, 708305, 171415, 101088607, 478564, 508571, 100061410
    Gene Symbol and Synonyms 2610016C12Rik,APG3,APG3-LIKE,APG3L,ATG3,Atg3l,hApg3,PC3-96,PIG-1,Pig1
    Uniprot Accession Q9NT62
    Uniprot Entry Name ATG3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000144848
    Target Classification Not Available

    This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.