Human GHRH/GHRF/GRF ORF/cDNA clone-Lentivirus particle (NM_001184731)
Cat. No.: vGMLP000190
Pre-made Human GHRH/GHRF/GRF Lentiviral expression plasmid for GHRH lentivirus packaging, GHRH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GHRH/GHRF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000190 | Human GHRH Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000190 |
Gene Name | GHRH |
Accession Number | NM_001184731 |
Gene ID | 2691 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 324 bp |
Gene Alias | GHRF,GRF,INN |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCACTCTGGGTGTTCTTCTTTGTGATCCTCACCCTCAGCAACAGCTCCCACTGCTCCCCACCTCCCCCTTTGACCCTCAGGATGCGGCGGTATGCAGATGCCATCTTCACCAACAGCTACCGGAAGGTGCTGGGCCAGCTGTCCGCCCGCAAGCTGCTCCAGGACATCATGAGCAGGCAGCAGGGAGAGAGCAACCAAGAGCGAGGAGCAAGGGCACGGCTTGGTCGTCAGGTAGACAGCATGTGGGCAGAACAAAAGCAAATGGAATTGGAGAGCATCCTGGTGGCCCTGCTGCAGAAGCACAGGAACTCCCAGGGATGA |
ORF Protein Sequence | MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0946-Ab | Anti-SLIB/ GHRH/ GHRF functional antibody |
Target Antigen | GM-Tg-g-SE0946-Ag | GHRH protein |
ORF Viral Vector | pGMLP000190 | Human GHRH Lentivirus plasmid |
ORF Viral Vector | vGMLP000190 | Human GHRH Lentivirus particle |
Target information
Target ID | GM-SE0946 |
Target Name | GHRH |
Gene ID | 2691, 14601, 701284, 29446, 101101046, 485863, 281191, 111769907 |
Gene Symbol and Synonyms | GHRF,GHRH,GRF,INN |
Uniprot Accession | P01286 |
Uniprot Entry Name | SLIB_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000118702 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a member of the glucagon family of proteins. The encoded preproprotein is produced in the hypothalamus and cleaved to generate the mature factor, known as somatoliberin, which acts to stimulate growth hormone release from the pituitary gland. Variant receptors for somatoliberin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.