Human GLIPR1/CRISP7/GLIPR ORF/cDNA clone-Lentivirus particle (NM_006851)

Cat. No.: vGMLP000567

Pre-made Human GLIPR1/CRISP7/GLIPR Lentiviral expression plasmid for GLIPR1 lentivirus packaging, GLIPR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GLIPR1/CRISP7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000567 Human GLIPR1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000567
Gene Name GLIPR1
Accession Number NM_006851
Gene ID 11010
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 801 bp
Gene Alias CRISP7,GLIPR,RTVP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGTGTCACACTTGCTACAATAGCCTGGATGGTTTCTTTTGTCTCCAATTATTCACACACAGCAAATATTTTGCCAGATATCGAAAATGAAGATTTCATCAAAGACTGCGTTCGAATCCATAACAAGTTCCGATCAGAGGTGAAACCAACAGCCAGTGATATGCTATACATGACTTGGGACCCAGCACTAGCCCAAATTGCAAAAGCATGGGCCAGCAATTGCCAGTTTTCACATAATACACGGCTGAAGCCACCCCACAAGCTGCACCCAAACTTCACTTCACTGGGAGAGAACATCTGGACTGGGTCTGTGCCCATTTTTTCTGTGTCTTCCGCCATCACAAACTGGTATGACGAAATCCAGGACTATGACTTCAAGACTCGGATATGCAAAAAAGTCTGTGGCCACTACACTCAGGTTGTTTGGGCAGATAGTTACAAAGTTGGCTGCGCAGTTCAATTTTGCCCTAAAGTTTCTGGCTTTGACGCTCTTTCCAATGGAGCACATTTTATATGCAACTACGGACCAGGAGGGAATTACCCAACTTGGCCATATAAGAGAGGAGCCACCTGCAGTGCCTGCCCCAATAATGACAAGTGTTTGGACAATCTCTGTGTTAACCGACAGCGAGACCAAGTCAAACGTTACTACTCTGTTGTATATCCAGGCTGGCCCATATATCCACGTAACAGATACACTTCTCTCTTTCTCATTGTTAATTCAGTAATTCTAATACTGTCTGTTATAATTACCATTTTGGTACAGCACAAGTACCCTAATTTAGTTCTTTTGGACTAA
ORF Protein Sequence MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T70201-Ab Anti-GLIP1/ GLIPR1/ CRISP7 monoclonal antibody
    Target Antigen GM-Tg-g-T70201-Ag GLIPR1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000567 Human GLIPR1 Lentivirus plasmid
    ORF Viral Vector vGMLP000567 Human GLIPR1 Lentivirus particle


    Target information

    Target ID GM-T70201
    Target Name GLIPR1
    Gene ID 11010, 73690, 718956, 299783, 101087587, 474452, 767905, 100058283
    Gene Symbol and Synonyms 2410114O14Rik,CRISP7,GLIPR,GLIPR1,mRTVP-1,RTVP-1,RTVP1
    Uniprot Accession P48060
    Uniprot Entry Name GLIP1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000139278
    Target Classification Not Available

    This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.