Human GLIPR1/CRISP7/GLIPR ORF/cDNA clone-Lentivirus particle (NM_006851)
Cat. No.: vGMLP000567
Pre-made Human GLIPR1/CRISP7/GLIPR Lentiviral expression plasmid for GLIPR1 lentivirus packaging, GLIPR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GLIPR1/CRISP7 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000567 | Human GLIPR1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000567 |
| Gene Name | GLIPR1 |
| Accession Number | NM_006851 |
| Gene ID | 11010 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 801 bp |
| Gene Alias | CRISP7,GLIPR,RTVP1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCGTGTCACACTTGCTACAATAGCCTGGATGGTTTCTTTTGTCTCCAATTATTCACACACAGCAAATATTTTGCCAGATATCGAAAATGAAGATTTCATCAAAGACTGCGTTCGAATCCATAACAAGTTCCGATCAGAGGTGAAACCAACAGCCAGTGATATGCTATACATGACTTGGGACCCAGCACTAGCCCAAATTGCAAAAGCATGGGCCAGCAATTGCCAGTTTTCACATAATACACGGCTGAAGCCACCCCACAAGCTGCACCCAAACTTCACTTCACTGGGAGAGAACATCTGGACTGGGTCTGTGCCCATTTTTTCTGTGTCTTCCGCCATCACAAACTGGTATGACGAAATCCAGGACTATGACTTCAAGACTCGGATATGCAAAAAAGTCTGTGGCCACTACACTCAGGTTGTTTGGGCAGATAGTTACAAAGTTGGCTGCGCAGTTCAATTTTGCCCTAAAGTTTCTGGCTTTGACGCTCTTTCCAATGGAGCACATTTTATATGCAACTACGGACCAGGAGGGAATTACCCAACTTGGCCATATAAGAGAGGAGCCACCTGCAGTGCCTGCCCCAATAATGACAAGTGTTTGGACAATCTCTGTGTTAACCGACAGCGAGACCAAGTCAAACGTTACTACTCTGTTGTATATCCAGGCTGGCCCATATATCCACGTAACAGATACACTTCTCTCTTTCTCATTGTTAATTCAGTAATTCTAATACTGTCTGTTATAATTACCATTTTGGTACAGCACAAGTACCCTAATTTAGTTCTTTTGGACTAA |
| ORF Protein Sequence | MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T70201-Ab | Anti-GLIP1/ GLIPR1/ CRISP7 monoclonal antibody |
| Target Antigen | GM-Tg-g-T70201-Ag | GLIPR1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000567 | Human GLIPR1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000567 | Human GLIPR1 Lentivirus particle |
Target information
| Target ID | GM-T70201 |
| Target Name | GLIPR1 |
| Gene ID | 11010, 73690, 718956, 299783, 101087587, 474452, 767905, 100058283 |
| Gene Symbol and Synonyms | 2410114O14Rik,CRISP7,GLIPR,GLIPR1,mRTVP-1,RTVP-1,RTVP1 |
| Uniprot Accession | P48060 |
| Uniprot Entry Name | GLIP1_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000139278 |
| Target Classification | Not Available |
This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


