Human RALA/RAL ORF/cDNA clone-Lentivirus particle (NM_005402)
Cat. No.: vGMLP000857
Pre-made Human RALA/RAL Lentiviral expression plasmid for RALA lentivirus packaging, RALA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
RALA/RAL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000857 | Human RALA Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000857 |
Gene Name | RALA |
Accession Number | NM_005402 |
Gene ID | 5898 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 621 bp |
Gene Alias | RAL |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTGCAAATAAGCCCAAGGGTCAGAATTCTTTGGCTTTACACAAAGTCATCATGGTGGGCAGTGGTGGCGTGGGCAAGTCAGCTCTGACTCTACAGTTCATGTACGATGAGTTTGTGGAGGACTATGAGCCTACCAAAGCAGACAGCTATCGGAAGAAGGTAGTGCTAGATGGGGAGGAAGTCCAGATCGATATCTTAGATACAGCTGGGCAGGAGGACTACGCTGCAATTAGAGACAACTACTTCCGAAGTGGGGAGGGGTTCCTCTGTGTTTTCTCTATTACAGAAATGGAATCCTTTGCAGCTACAGCTGACTTCAGGGAGCAGATTTTAAGAGTAAAAGAAGATGAGAATGTTCCATTTCTACTGGTTGGTAACAAATCAGATTTAGAAGATAAAAGACAGGTTTCTGTAGAAGAGGCAAAAAACAGAGCTGAGCAGTGGAATGTTAACTACGTGGAAACATCTGCTAAAACACGAGCTAATGTTGACAAGGTATTTTTTGATTTAATGAGAGAAATTCGAGCGAGAAAGATGGAAGACAGCAAAGAAAAGAATGGAAAAAAGAAGAGGAAAAGTTTAGCCAAGAGAATCAGAGAAAGATGCTGCATTTTATAA |
ORF Protein Sequence | MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2279-Ab | Anti-RALA/ RAL monoclonal antibody |
Target Antigen | GM-Tg-g-MP2279-Ag | RALA VLP (virus-like particle) |
ORF Viral Vector | pGMLP000857 | Human RALA Lentivirus plasmid |
ORF Viral Vector | pGMLP005654 | Human RALA Lentivirus plasmid |
ORF Viral Vector | pGMLP005819 | Human RALA Lentivirus plasmid |
ORF Viral Vector | vGMLP000857 | Human RALA Lentivirus particle |
ORF Viral Vector | vGMLP005654 | Human RALA Lentivirus particle |
ORF Viral Vector | vGMLP005819 | Human RALA Lentivirus particle |
Target information
Target ID | GM-MP2279 |
Target Name | RALA |
Gene ID | 5898, 56044, 703440, 81757, 101091003, 475875, 538477, 100051360 |
Gene Symbol and Synonyms | 3010001O15Rik,HINCONS,RAL,RALA,Rasl1 |
Uniprot Accession | P11233 |
Uniprot Entry Name | RALA_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000006451 |
Target Classification | Tumor-associated antigen (TAA) |
The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.