Human RALA/RAL ORF/cDNA clone-Lentivirus particle (NM_005402.3)

Cat. No.: vGMLP005819

Pre-made Human RALA/RAL Lentiviral expression plasmid for RALA lentivirus packaging, RALA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RALA/RAL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005819 Human RALA Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005819
Gene Name RALA
Accession Number NM_005402.3
Gene ID 5898
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 621 bp
Gene Alias RAL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCAAATAAGCCCAAGGGTCAGAATTCTTTGGCTTTACACAAAGTCATCATGGTGGGCAGTGGTGGCGTGGGCAAGTCAGCTCTGACTCTACAGTTCATGTACGATGAGTTTGTGGAGGACTATGAGCCTACCAAAGCAGACAGCTATCGGAAGAAGGTAGTGCTAGATGGGGAGGAAGTCCAGATCGATATCTTAGATACAGCTGGGCAGGAGGACTACGCTGCAATTAGAGACAACTACTTCCGAAGTGGGGAGGGGTTCCTCTGTGTTTTCTCTATTACAGAAATGGAATCCTTTGCAGCTACAGCTGACTTCAGGGAGCAGATTTTAAGAGTAAAAGAAGATGAGAATGTTCCATTTCTACTGGTTGGTAACAAATCAGATTTAGAAGATAAAAGACAGGTTTCTGTAGAAGAGGCAAAAAACAGAGCTGAGCAGTGGAATGTTAACTACGTGGAAACATCTGCTAAAACACGAGCTAATGTTGACAAGGTATTTTTTGATTTAATGAGAGAAATTCGAGCGAGAAAGATGGAAGACAGCAAAGAAAAGAATGGAAAAAAGAAGAGGAAAAGTTTAGCCAAGAGAATCAGAGAAAGATGCTGCATTTTATAA
ORF Protein Sequence MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2279-Ab Anti-RALA/ RAL monoclonal antibody
    Target Antigen GM-Tg-g-MP2279-Ag RALA VLP (virus-like particle)
    ORF Viral Vector pGMLP000857 Human RALA Lentivirus plasmid
    ORF Viral Vector pGMLP005654 Human RALA Lentivirus plasmid
    ORF Viral Vector pGMLP005819 Human RALA Lentivirus plasmid
    ORF Viral Vector vGMLP000857 Human RALA Lentivirus particle
    ORF Viral Vector vGMLP005654 Human RALA Lentivirus particle
    ORF Viral Vector vGMLP005819 Human RALA Lentivirus particle


    Target information

    Target ID GM-MP2279
    Target Name RALA
    Gene ID 5898, 56044, 703440, 81757, 101091003, 475875, 538477, 100051360
    Gene Symbol and Synonyms 3010001O15Rik,HINCONS,RAL,RALA,Rasl1
    Uniprot Accession P11233
    Uniprot Entry Name RALA_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000006451
    Target Classification Tumor-associated antigen (TAA)

    The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.