Human ARL4C/ARL7/LAK ORF/cDNA clone-Lentivirus particle (NM_001282431)

Cat. No.: vGMLP000882

Pre-made Human ARL4C/ARL7/LAK Lentiviral expression plasmid for ARL4C lentivirus packaging, ARL4C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ARL4C/ARL7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000882 Human ARL4C Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000882
Gene Name ARL4C
Accession Number NM_001282431
Gene ID 10123
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 606 bp
Gene Alias ARL7,LAK
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAACATCTCCTCTAACATCTCGGCCTTCCAGTCCCTGCATATCGTCATGTTGGGCTTGGACTCGGCCGGCAAGACCACGGTGCTCTACCGGCTCAAGTTCAACGAGTTCGTGAACACGGTGCCCACCATCGGCTTCAACACCGAGAAGATCAAGCTGAGCAACGGCACGGCCAAGGGCATCAGCTGCCACTTCTGGGACGTGGGCGGCCAGGAGAAGCTGCGGCCGCTGTGGAAGTCCTACAGCCGCTGCACGGACGGCATCATCTACGTGGTGGACTCGGTGGACGTGGACCGGCTGGAGGAGGCCAAGACGGAGCTGCACAAGGTGACCAAGTTCGCCGAGAACCAGGGCACGCCGCTGCTGGTCATCGCCAACAAGCAGGACCTGCCCAAGTCGCTGCCGGTGGCAGAGATTGAGAAGCAGCTGGCGCTGCACGAGCTTATCCCGGCCACCACCTATCACGTCCAGCCGGCGTGCGCCATCATCGGCGAGGGCCTCACCGAGGGCATGGACAAGCTCTATGAGATGATCCTGAAACGCAGGAAGTCCCTCAAGCAGAAGAAGAAGCGGACTGGTGACTTAAGGAGCTGCGAAGTCTGA
ORF Protein Sequence MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKRTGDLRSCEV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2007-Ab Anti-ARL4C/ ARL7/ LAK monoclonal antibody
    Target Antigen GM-Tg-g-MP2007-Ag ARL4C VLP (virus-like particle)
    ORF Viral Vector pGMLP000882 Human ARL4C Lentivirus plasmid
    ORF Viral Vector vGMLP000882 Human ARL4C Lentivirus particle


    Target information

    Target ID GM-MP2007
    Target Name ARL4C
    Gene ID 10123, 320982, 715121, 103693239, 102899834, 100685179, 788039, 100057460
    Gene Symbol and Synonyms A630084M22Rik,ARL4C,Arl4c-ps1,ARL7,LAK
    Uniprot Accession P56559
    Uniprot Entry Name ARL4C_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000188042
    Target Classification Not Available

    ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.