Human HINT1/HINT/NMAN ORF/cDNA clone-Lentivirus particle (NM_005340)
Cat. No.: vGMLP000950
Pre-made Human HINT1/HINT/NMAN Lentiviral expression plasmid for HINT1 lentivirus packaging, HINT1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
HINT1/HINT products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000950 | Human HINT1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000950 |
Gene Name | HINT1 |
Accession Number | NM_005340 |
Gene ID | 3094 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 381 bp |
Gene Alias | HINT,NMAN,PKCI-1,PRKCNH1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCAGATGAGATTGCCAAGGCTCAGGTCGCTCGGCCTGGTGGCGACACGATCTTTGGGAAGATCATCCGCAAGGAAATACCAGCCAAAATCATTTTTGAGGATGACCGGTGCCTTGCTTTCCATGACATTTCCCCTCAAGCACCAACACATTTTCTGGTGATACCCAAGAAACATATATCCCAGATTTCTGTGGCAGAAGATGATGATGAAAGTCTTCTTGGACACTTAATGATTGTTGGCAAGAAATGTGCTGCTGATCTGGGCCTGAATAAGGGTTATCGAATGGTGGTGAATGAAGGTTCAGATGGTGGACAGTCTGTCTATCACGTTCATCTCCATGTTCTTGGAGGTCGGCAAATGCATTGGCCTCCTGGTTAA |
ORF Protein Sequence | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2160-Ab | Anti-HINT1/ HINT/ NMAN monoclonal antibody |
Target Antigen | GM-Tg-g-MP2160-Ag | HINT1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000950 | Human HINT1 Lentivirus plasmid |
ORF Viral Vector | vGMLP000950 | Human HINT1 Lentivirus particle |
Target information
Target ID | GM-MP2160 |
Target Name | HINT1 |
Gene ID | 3094, 15254, 706083, 690660, 101083139, 474667, 327693, 100072940 |
Gene Symbol and Synonyms | HINT,HINT1,Ipk1,NMAN,Pkci,PKCI-1,Prkci,PRKCNH1 |
Uniprot Accession | P49773 |
Uniprot Entry Name | HINT1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Type 2 diabetes mellitus |
Gene Ensembl | ENSG00000169567 |
Target Classification | Not Available |
This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.