Human HINT1/HINT/NMAN ORF/cDNA clone-Lentivirus particle (NM_005340)

Cat. No.: vGMLP000950

Pre-made Human HINT1/HINT/NMAN Lentiviral expression plasmid for HINT1 lentivirus packaging, HINT1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HINT1/HINT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000950 Human HINT1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000950
Gene Name HINT1
Accession Number NM_005340
Gene ID 3094
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 381 bp
Gene Alias HINT,NMAN,PKCI-1,PRKCNH1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGATGAGATTGCCAAGGCTCAGGTCGCTCGGCCTGGTGGCGACACGATCTTTGGGAAGATCATCCGCAAGGAAATACCAGCCAAAATCATTTTTGAGGATGACCGGTGCCTTGCTTTCCATGACATTTCCCCTCAAGCACCAACACATTTTCTGGTGATACCCAAGAAACATATATCCCAGATTTCTGTGGCAGAAGATGATGATGAAAGTCTTCTTGGACACTTAATGATTGTTGGCAAGAAATGTGCTGCTGATCTGGGCCTGAATAAGGGTTATCGAATGGTGGTGAATGAAGGTTCAGATGGTGGACAGTCTGTCTATCACGTTCATCTCCATGTTCTTGGAGGTCGGCAAATGCATTGGCCTCCTGGTTAA
ORF Protein Sequence MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2160-Ab Anti-HINT1/ HINT/ NMAN monoclonal antibody
    Target Antigen GM-Tg-g-MP2160-Ag HINT1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000950 Human HINT1 Lentivirus plasmid
    ORF Viral Vector vGMLP000950 Human HINT1 Lentivirus particle


    Target information

    Target ID GM-MP2160
    Target Name HINT1
    Gene ID 3094, 15254, 706083, 690660, 101083139, 474667, 327693, 100072940
    Gene Symbol and Synonyms HINT,HINT1,Ipk1,NMAN,Pkci,PKCI-1,Prkci,PRKCNH1
    Uniprot Accession P49773
    Uniprot Entry Name HINT1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Type 2 diabetes mellitus
    Gene Ensembl ENSG00000169567
    Target Classification Not Available

    This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.