Human STX1B/GEFSP9/STX1B1 ORF/cDNA clone-Lentivirus particle (NM_052874)

Cat. No.: vGMLP000968

Pre-made Human STX1B/GEFSP9/STX1B1 Lentiviral expression plasmid for STX1B lentivirus packaging, STX1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to STX1B/GEFSP9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000968 Human STX1B Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000968
Gene Name STX1B
Accession Number NM_052874
Gene ID 112755
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 867 bp
Gene Alias GEFSP9,STX1B1,STX1B2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGATCGGACTCAAGAGCTGCGGAGTGCGAAAGACAGTGATGATGAAGAGGAGGTGGTCCACGTGGATCGGGACCACTTCATGGATGAGTTCTTTGAACAGGTGGAAGAGATCCGGGGCTGCATTGAGAAACTGTCGGAGGATGTGGAGCAGGTGAAAAAACAGCATAGCGCCATCCTGGCCGCACCCAACCCAGATGAGAAGACCAAACAGGAGCTGGAGGATCTCACTGCAGACATCAAGAAGACGGCCAACAAGGTTCGGTCCAAATTGAAAGCGATCGAGCAAAGCATTGAACAGGAGGAGGGGCTGAACCGTTCCTCCGCGGACCTGCGCATCCGCAAGACCCAGCACTCCACACTGTCCCGGAAGTTCGTGGAGGTAATGACCGAATATAACGCGACCCAGTCCAAGTACCGGGACCGCTGCAAGGACCGGATCCAGCGGCAACTGGAGATCACTGGAAGGACCACCACCAACGAAGAACTGGAAGACATGCTGGAGAGCGGGAAGCTGGCCATCTTCACAGATGACATCAAAATGGACTCACAGATGACGAAGCAGGCGCTGAATGAGATTGAGACGAGGCACAATGAGATCATCAAGCTGGAGACCAGCATCCGCGAGCTGCACGATATGTTTGTGGACATGGCCATGCTCGTAGAGAGCCAGGGAGAGATGATTGACCGCATCGAGTACAACGTGGAACATTCTGTGGACTACGTGGAGCGAGCTGTGTCTGACACCAAGAAAGCAGTGAAATATCAGAGCAAGGCCCGGAGGAAGAAAATCATGATCATCATTTGCTGTGTGGTGCTGGGGGTGGTCTTGGCGTCATCCATTGGGGGGACGCTGGGCTTGTAG
ORF Protein Sequence MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1725-Ab Anti-STX1B/ GEFSP91/ STX1B2 monoclonal antibody
    Target Antigen GM-Tg-g-MP1725-Ag STX1B VLP (virus-like particle)
    ORF Viral Vector pGMLP000968 Human STX1B Lentivirus plasmid
    ORF Viral Vector vGMLP000968 Human STX1B Lentivirus particle


    Target information

    Target ID GM-MP1725
    Target Name STX1B
    Gene ID 112755, 56216, 714251, 24923, 101083133, 489918, 282377, 100146591
    Gene Symbol and Synonyms GEFSP9,STX1B,STX1B1,STX1B2,Stx1bl,Stx2,Syn1b
    Uniprot Accession P61266
    Uniprot Entry Name STX1B_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000099365
    Target Classification Not Available

    The protein encoded by this gene belongs to a family of proteins thought to play a role in the exocytosis of synaptic vesicles. Vesicle exocytosis releases vesicular contents and is important to various cellular functions. For instance, the secretion of transmitters from neurons plays an important role in synaptic transmission. After exocytosis, the membrane and proteins from the vesicle are retrieved from the plasma membrane through the process of endocytosis. Mutations in this gene have been identified as one cause of fever-associated epilepsy syndromes. A possible link between this gene and Parkinson's disease has also been suggested. [provided by RefSeq, Jan 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.