Human CEP57/MVA2/PIG8 ORF/cDNA clone-Lentivirus particle (NM_014679)

Cat. No.: vGMLP001070

Pre-made Human CEP57/MVA2/PIG8 Lentiviral expression plasmid for CEP57 lentivirus packaging, CEP57 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CEP57/MVA2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001070 Human CEP57 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001070
Gene Name CEP57
Accession Number NM_014679
Gene ID 9702
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1503 bp
Gene Alias MVA2,PIG8,TSP57
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCGTCTGTCTCTGCGGCTTCTGGTTCTCACTTGTCGAACAGCTTTGCTGAGCCATCAAGGTCTAATGGAAGCATGGTTCGGCATTCTTCATCTCCATATGTAGTATATCCTTCGGATAAGCCTTTCCTTAATAGTGATCTACGACGCTCCCCAAGTAAGCCTACACTTGCCTATCCAGAAAGCAACAGCAGAGCCATATTTTCTGCTCTTAAGAATCTTCAAGATAAGATTCGACGCTTGGAACTTGAGAGGATTCAGGCAGAAGAAAGTGTGAAAACCTTGTCTAGAGAAACAATTGAATATAAGAAAGTACTGGATGAACAGATACAAGAAAGGGAGAATTCAAAGAATGAGGAATCAAAGCACAATCAAGAACTGACATCTCAGTTGTTAGCTGCAGAAAATAAATGCAATCTATTAGAAAAACAATTGGAATACATGCGAAATATGATAAAGCATGCCGAAATGGAGAGGACATCTGTCTTAGAGAAACAAGTTTCCCTAGAAAGAGAACGACAACATGATCAAACACATGTTCAGAGCCAACTTGAAAAATTGGATCTTCTTGAACAGGAGTATAACAAACTTACCACAATGCAGGCCCTTGCAGAAAAAAAAATGCAAGAGTTGGAAGCAAAACTCCATGAAGAAGAACAGGAAAGGAAACGCATGCAAGCTAAGGCAGCTGAGTTGCAGACTGGTCTAGAAACAAATAGACTTATCTTTGAAGATAAGGCAACTCCGTGTGTTCCCAATGCAAGAAGAATTAAAAAAAAGAAGTCAAAACCACCAGAAAAGAAAAGTTCTAGGAACTATTTTGGTGCACAACCACATTATAGATTATGCTTGGGTGATATGCCATTTGTAGCTGGGAAGTCCACAAGCCCTAGCCATGCCGTGGTAGCCAATGTTCAGCTTGTCTTGCATCTAATGAAGCAACACAGTAAAGCTTTGTGCAATGATCGAGTCATCAACAGTATTCCTTTGGCAAAGCAAGTATCTTCACGAGGTGGTAAAAGTAAGAAGTTGTCAGTAACACCTCCCTCCTCCAACGGTATTAATGAGGAGTTGTCAGAAGTCTTACAGACTTTACAGGATGAATTTGGGCAAATGAGCTTTGATCACCAGCAGCTTGCAAAACTTATCCAGGAGTCGCCAACCGTTGAACTGAAAGACAAGTTGGAGTGTGAATTGGAGGCATTAGTGGGAAGGATGGAAGCAAAAGCCAACCAAATAACTAAAGTTCGAAAATACCAAGCCCAGCTGGAGAAACAGAAGTTAGAGAAGCAGAAGAAGGAATTAAAAGCTACCAAAAAGACTCTTGATGAAGAAAGAAACAGCAGCAGCCGTTCTGGAATCACAGGGACCACAAATAAGAAAGATTTTATGAAACTGAGACCTGGAGAAAAAAGGAGAAAAAATCTTCAGTTATTGAAGGACATGCAAAGCATACAGAATTCATTACAAAGCAGTAGTTTGTGTTGGGATTACTGA
ORF Protein Sequence MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1572-Ab Anti-CEP57/ MVA2/ PIG8 functional antibody
    Target Antigen GM-Tg-g-SE1572-Ag CEP57 protein
    ORF Viral Vector pGMLP001070 Human CEP57 Lentivirus plasmid
    ORF Viral Vector vGMLP001070 Human CEP57 Lentivirus particle


    Target information

    Target ID GM-SE1572
    Target Name CEP57
    Gene ID 9702, 74360, 699835, 315423, 101084902, 476766, 353245, 100067852
    Gene Symbol and Synonyms 3110002L15Rik,4921510P06Rik,4931428M20Rik,CEP57,mKIAA0092,MVA2,PIG8,RGD1309884,TSP57
    Uniprot Accession Q86XR8
    Uniprot Entry Name CEP57_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000166037
    Target Classification Not Available

    This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerization, and the C-terminal half is required for nucleating, bundling and anchoring microtubules to the centrosomes. This protein specifically interacts with fibroblast growth factor 2 (FGF2), sorting nexin 6, Ran-binding protein M and the kinesins KIF3A and KIF3B, and thus mediates the nuclear translocation and mitogenic activity of the FGF2. It also interacts with cyclin D1 and controls nucleocytoplasmic distribution of the cyclin D1 in quiescent cells. This protein is crucial for maintaining correct chromosomal number during cell division. Mutations in this gene cause mosaic variegated aneuploidy syndrome, a rare autosomal recessive disorder. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.